KEGG   Meleagris gallopavo (turkey): 100543421Help
Entry
100543421         CDS       T01523                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04012  ErbB signaling pathway
mgp04068  FoxO signaling pathway
mgp04114  Oocyte meiosis
mgp04140  Autophagy - animal
mgp04150  mTOR signaling pathway
mgp04210  Apoptosis
mgp04218  Cellular senescence
mgp04270  Vascular smooth muscle contraction
mgp04370  VEGF signaling pathway
mgp04371  Apelin signaling pathway
mgp04510  Focal adhesion
mgp04540  Gap junction
mgp04620  Toll-like receptor signaling pathway
mgp04810  Regulation of actin cytoskeleton
mgp04910  Insulin signaling pathway
mgp04912  GnRH signaling pathway
mgp04914  Progesterone-mediated oocyte maturation
mgp04916  Melanogenesis
mgp05164  Influenza A
Module
mgp_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100543421 (MAP2K1)
   04012 ErbB signaling pathway
    100543421 (MAP2K1)
   04370 VEGF signaling pathway
    100543421 (MAP2K1)
   04371 Apelin signaling pathway
    100543421 (MAP2K1)
   04068 FoxO signaling pathway
    100543421 (MAP2K1)
   04150 mTOR signaling pathway
    100543421 (MAP2K1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100543421 (MAP2K1)
  Cell growth and death
   04114 Oocyte meiosis
    100543421 (MAP2K1)
   04210 Apoptosis
    100543421 (MAP2K1)
   04218 Cellular senescence
    100543421 (MAP2K1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100543421 (MAP2K1)
   04540 Gap junction
    100543421 (MAP2K1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100543421 (MAP2K1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100543421 (MAP2K1)
  Endocrine system
   04910 Insulin signaling pathway
    100543421 (MAP2K1)
   04912 GnRH signaling pathway
    100543421 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100543421 (MAP2K1)
   04916 Melanogenesis
    100543421 (MAP2K1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100543421 (MAP2K1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100543421 (MAP2K1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100543421 (MAP2K1)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: STE group
  STE7 family
   100543421 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 Kinase-like DUF3216 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100543421
NCBI-ProteinID: XP_010715893
Position
12
AA seq 389 aa AA seqDB search
MEPWQRRSFVTVKKQLQDCRRTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDD
DFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYI
VGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKI
MHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDI
WSMGLSLVEMAIGRYPIPPPDSKELELMFGCPVEGDSPVTETSPRQRTPGRPLSSYGPDS
RPPMAIFELLDYIVNEPPPKLPNGVFGSEFQDFVNKCLIKNPAERADLKQLMIHAFIKRS
EAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaaccctggcaaagacgtagctttgtgacagtgaaaaaacagctccaagactgcaga
aggacaaacttggaagcgcttcagaagaagctggaagagctagagttggatgaacagcaa
cggaagcgccttgaagctttccttacccagaaacaaaaagttggggagctgaaggatgac
gactttgagaagatcagtgagctgggagcagggaatggtggggtggtgttcaaagtgtct
cacaagccttctggcctcatcatggcaagaaagttgattcatctagagatcaagccagct
attcgaaaccagatcatccgtgagctgcaggttctacatgagtgcaattcaccatacata
gtgggcttttatggagctttttacagcgatggggaaatcagcatttgcatggaacacatg
gatggtggctcgttggatcaagtgctgaaaaaggctggaagaattccagagcagatactg
ggcaaagtcagcattgcagtaataaaaggactcacatatctgagagaaaagcataaaata
atgcacagagatgttaaaccatctaacattttggtaaactctagaggtgagatcaagctt
tgtgattttggtgtcagtggacaactgatagattctatggcaaactcatttgtcggcacg
cgctcctacatgtctccggaaaggctgcagggaactcattattcagtgcagtcggatata
tggagtatggggctgtctctggtagagatggccattggcagataccccattcctcctcct
gactctaaggagctcgagttgatgtttggctgcccggtagaaggagattctccagtcaca
gagacctcacccaggcaaagaacacctggtcgaccactgagctcctatggaccagacagc
agacccccgatggcaatctttgaacttctggattacatcgtcaatgagccacctccaaaa
ctgcccaatggtgtttttggttctgaatttcaagattttgttaacaaatgtttaattaaa
aatcctgctgagagagccgatttgaagcagctgatgattcatgctttcattaagagatct
gaagcagaggaggtggattttgcaggatggctttgctcaaccataggccttaaccaacca
agcacacccacgcatgctgctggagtctga

DBGET integrated database retrieval system