KEGG   Meleagris gallopavo (turkey): 100543421Help
Entry
100543421         CDS       T01523                                 

Definition
dual specificity mitogen-activated protein kinase kinase 1-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
Vascular smooth muscle contraction
Dorso-ventral axis formation
VEGF signaling pathway
Focal adhesion
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100543421
   04012 ErbB signaling pathway
    100543421
   04370 VEGF signaling pathway
    100543421
   04068 FoxO signaling pathway
    100543421
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100543421
  Cell growth and death
   04114 Oocyte meiosis
    100543421
  Cell communication
   04510 Focal adhesion
    100543421
   04540 Gap junction
    100543421
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100543421
  Endocrine system
   04910 Insulin signaling pathway
    100543421
   04912 GnRH signaling pathway
    100543421
   04914 Progesterone-mediated oocyte maturation
    100543421
   04916 Melanogenesis
    100543421
  Circulatory system
   04270 Vascular smooth muscle contraction
    100543421
  Development
   04320 Dorso-ventral axis formation
    100543421
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100543421
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100543421
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100543421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 434 aa AA seqDB search
MRVLDLQLVPSTCRPEVSSSQAQDAPGSSQPEHKAVLRTSSPQTDSQTGRPGGSVRTDIR
REPGTARRTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNG
GVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEI
SICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVILGFLREKHFIFSPDVKPSNILVNSR
GEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRY
PIPPPDSKELELMFGCPVEGDSPVTETSPRQRTPGRPLSSYGPDSRPPMAIFELLDYIVN
EPPPKLPNGVFGSEFQDFVNKCLIKNPAERADLKQLMIHAFIKRSEAEEVDFAGWLCSTI
GLNQPSTPTHAAGV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcctcgacttacagcttgtcccttcaacctgcaggccggaggtctcctcctct
caggctcaggacgccccgggctcctcgcagcctgagcacaaggcggttttaaggacaagc
tctccacagacggattcacagacaggacgcccgggcggctccgtccgcaccgacatccga
cgggagcccggcacggccagacggacaaacttggaagcgcttcagaagaagctggaagag
ctagagttggatgaacagcaacggaagcgccttgaagctttccttacccagaaacaaaaa
gttggggagctgaaggatgacgactttgagaagatcagtgagctgggagcagggaatggt
ggggtggtgttcaaagtgtctcacaagccttctggcctcatcatggcaagaaagttgatt
catctagagatcaagccagctattcgaaaccagatcatccgtgagctgcaggttctacat
gagtgcaattcaccatacatagtgggcttttatggagctttttacagcgatggggaaatc
agcatttgcatggaacacatggatggtggctcgttggatcaagtgctgaaaaaggctgga
agaattccagagcagatactgggcaaagtcagcattgcagtaattctgggtttcctcagg
gagaaacattttattttttccccagatgttaaaccatctaacattttggtaaactctaga
ggtgagatcaagctttgtgattttggtgtcagtggacaactgatagattctatggcaaac
tcatttgtcggcacgcgctcctacatgtctccggaaaggctgcagggaactcattattca
gtgcagtcggatatatggagtatggggctgtctctggtagagatggccattggcagatac
cccattcctcctcctgactctaaggagctcgagttgatgtttggctgcccagtagaagga
gattctccagtcacagagacctcacccaggcaaagaacacctggtcgaccactgagctcc
tatggaccagacagcagacccccgatggcaatctttgaacttctggattacatcgtcaat
gagccacctccaaaactgcccaatggtgtttttggttctgaatttcaagattttgttaac
aaatgtttaattaaaaatcctgctgagagagccgatttgaagcagctgatgattcatgct
ttcattaagagatctgaagcagaggaggtggattttgcaggatggctttgctcaaccata
ggccttaaccaaccaagcacacccacgcatgctgctggagtctga

DBGET integrated database retrieval system