KEGG   Meleagris gallopavo (turkey): 100543470Help
Entry
100543470         CDS       T01523                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100543470
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100543470
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100543470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 367 aa AA seqDB search
MAAAILRVAVTAAGRTAPAPGFAAASRGRLPPGKRWNGAEESCKCNGWKNPNPPPTPPRA
DLQQAVVSLTEPCRSCSHTLAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADT
KQVYFYLFKLLRKCILQMGKPVIEGSLESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTI
VELAKMFLNRINYWHLETPSQRRLRSPNDDIAGYKVNYTRWLCYCNVPQFCDSLPRYETT
QVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRTLILTHFPKFLSMLEEEVYSPNSPI
WDQDFMVSTSRTGQLGIQTVINPPPVARSVSYCASPSSLEQPNSGNMSPACKVSSVLDPN
LGNKDGD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccatcttacgggtcgctgtcacagctgccggcaggaccgcgccagcgccg
ggcttcgccgcagcctcccgaggccgcttaccgccgggcaagagatggaacggggctgag
gagtcgtgtaaatgcaatggctggaagaaccccaacccacctcccacaccccctcgggca
gacctgcaacaggcagttgtgagccttactgagccgtgccgcagctgcagtcacacacta
gctgctcatgtttcccacctggagaatgtgtctgaagaagaaatgaataggctgctgggg
attgtactggatgtggagtatctgttcacctgtgtccataaagaagaagatgcagacacc
aagcaagtttatttctacctgttcaaacttttgaggaagtgcattttacagatgggaaaa
cctgttattgaaggatctttggaaagtcccccatttgagaagcctagcattgagcagggt
gtgaataattttgtgcagtacaaatttagccacttaccctcaaaggaaaggcagacaata
gtggaactggctaaaatgtttctgaaccgcattaactattggcacctggagacaccttct
caacgaagactaagatcacccaatgatgatattgcagggtataaagtgaattataccagg
tggctttgttactgcaatgtccctcagttctgtgatagtctacctcgatatgaaaccacg
caggtttttggcaggacattgcttcgctccgtctttactgtaatgagacggcaactgctg
gagcaggccaggcaagagaaagacaagcttcctcaagagaaacggacactaatcctcacc
catttcccaaagtttctgtcaatgctggaagaagaagtctacagcccaaattctcctatt
tgggatcaggatttcatggtgtctacttctcgaactggccagctgggaatccagacagtt
atcaatcctcctcctgttgcaagatctgtttcatattgtgcaagcccgtcatctctggag
caacccaatagtggaaatatgagtcctgcttgcaaagtttcttcagtccttgacccaaac
ttaggtaacaaagacggagactga

DBGET integrated database retrieval system