KEGG   Meleagris gallopavo (turkey): 100543516Help
Entry
100543516         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 38-like
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100543516
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100543516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1027 aa AA seqDB search
MAGQLHRAPSLSAGMKYALTCIDTASGLLQAYPVLKANQAYTIKALTKRMSAYGTPQVIQ
SDQGTNFTGAMIQCWAEENNIKWQFHLPYNPTGAGLIKCSKXXXXXXXXXVLELFELLQV
EALRLVCERPAPPLCARLCQLLGDFPQCLPRGRKLSLAFCQQLVRSIAHFQSRGSREAEL
RLYVSQVTQVSGLLRSVWKAEPDTLLPSLQELFAVIAAADTPFEPSVALASLVQHIPLQM
ITVLIMSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVETWVIALLKGLAAVQKFTILID
VTLMKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVSLVHSFKSDGLP
SSAAFLMQLAELIHCMMYHYSGFPELYEPILEVFKDMPKPSEEKMKLILSQSAWTSQSNS
LPSCLSRLPGKSETGKTGLINLGNTCYMNSIIQALYMATDFRRHVLSLNLNGCNSLMRKL
QHLFAFLAHTQREAYAPRIFLEASRPPWFTPQSQQDCSEYLRFLLNRLHEEEKTLKALSS
AKAAESRRNEESQAQETIHKAQVFAEALCKGSEERTLIERMFGGKLKTTICCLNCKSTSQ
KEEAFTDLSLAFCPPTSLESASVKCVEHAEMKDSSVVQTTISASSAGETPLSRLEINSGC
NALTNEGILKDFSAEPNSETKSEFNKDQDNRDVSSALVGKSTPSVTDLLNYFLAPEILSG
DNKYYCEKCASLQNAEKTMQIVEEPEYLILTLLRFSYDPKCHVRRKILDSVSLPLLLELP
VKRATSPLAVVSGSWSVDVEISDIGENLAKKLKPSGADEVSCPQLVPYVLSSVVVHSGVS
SESGHYYSYARNVTGSGSSGQCHQSKAFSLISPQNKLLAEESPCTVIENELDTEMPKEWF
LFNDSRVTFTSFQSVQKITSRFPKDTAYVLIYKKQNSTCGYNTNSANGLWVNGDPPLQKD
LMDAITKDNKLYLQEQELSARTQALQAASASCSFRPNGFDDNDPPGSCGPAGGGGGGGFS
TVGRLVF
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtcaattacatcgggccccttctctgtctgcggggatgaaatatgccctgaca
tgcattgacactgcaagtgggctactgcaggcctatccagtgctgaaagcaaaccaggca
tataccatcaaggcactcacaaaacggatgtctgcctatgggacgcctcaagtcatccag
agcgaccaaggaactaattttactggtgcaatgatacaatgctgggcagaagaaaataac
atcaaatggcaattccacctgccatataatccaacaggggcaggcctcatcaaatgttct
aaggnnnnnnnnnnnnnnnnnnnnnnnncggtgctggagctcttcgagctgctgcaggtg
gaggccctgcgcctggtgtgtgagcggcccgcgccgccgctctgcgctcgcctgtgccag
ctgctgggcgacttcccgcagtgcctgccccgcggcaggaagctctcgctcgccttctgc
cagcagctggtgcgcagcatcgcccactttcagagccggggcagccgcgaggccgagctg
cgcctctacgtctcgcaggtgacgcaggtcagcgggctgctgcgcagcgtttggaaggcc
gagcccgacacgctgctgccctccctgcaggagctcttcgccgtcatcgccgccgccgat
actccgtttgaaccctctgttgcactggcaagtcttgtgcagcatatacctttgcagatg
attacagtactcatcatgagccttactacagacccaaatgtgaaagatgcgagtatgact
caagcgctgtgcagaatgattgactggttgtcttggcctctggctcagcatgtggaaacg
tgggtgattgcactgctgaaaggactagctgcagtccagaaatttactatccttattgat
gtcactctgatgaagattgaactggtctttaaccgactttggttccctttagtaagacct
ggtgcccttgctgttctttctcatatgttacttagcttccagcattctccagaagctttt
catttgattgttccacatgtggtcagcttggttcactccttcaaaagtgatggcttgcct
tccagtgcagcgttcttgatgcagttggctgagttgatacattgtatgatgtatcattat
tcaggttttccagagctctatgaacccattctggaagtttttaaggatatgcccaagccc
agcgaagaaaaaatgaagctgattctcagtcagagtgcctggacttctcaatccaattct
ttgccatcttgtttatctagacttcctggaaaatctgaaactggaaagacgggcctgatt
aacctagggaatacctgctacatgaacagcattattcaggcactttacatggctactgat
ttcagaagacatgttttatctctgaatctaaatggttgtaattcattgatgagaaaatta
cagcatctttttgcatttttggcccatacccagagggaggcgtacgctcctagaattttc
cttgaggcttccagaccaccatggttcacccctcaatcacaacaggattgctcagaatat
ctccggttcctgctcaacaggctgcatgaagaagagaaaactttgaaagcgttgtcttca
gcaaaggctgctgaaagtaggaggaatgaagagtcccaggcacaagaaactatccataaa
gcacaggtatttgccgaagcactttgtaaggggagtgaagaaagaactctcatagagaga
atgtttggaggaaaactgaagactactatatgctgtttgaactgcaaaagcacatctcaa
aaggaggaagcttttacagatctctctttggctttctgtcctccgacgtccttggaaagc
gctagtgtgaaatgtgtggaacatgcagaaatgaaagacagctctgtggtgcaaactact
atttcagcaagttctgctggagaaacacctctcagtagattggaaataaacagtggatgc
aacgcacttacaaatgaaggaatccttaaggatttttctgctgagccaaactctgagaca
aaatctgaatttaacaaggatcaagataatagggatgtttcttctgcattagtagggaaa
agcaccccatcggtaacggacttattgaattattttctggcacctgagatccttagtgga
gacaataagtattattgtgagaagtgtgcctctctacaaaatgctgagaaaactatgcaa
atcgttgaggaacctgaatacctcattctcactcttctgagattttcatacgatccaaag
tgtcatgtaagacgtaaaatcttggacagcgtttctctgccacttcttttggaactgcca
gtcaaaagagcgacatcccctctagctgtggtttcaggaagttggtctgttgatgttgag
atttctgatattggagaaaatcttgctaaaaagttaaagccctcaggtgctgatgaagtg
tcctgcccacagctggtgccctatgtgctaagttctgtggtggtgcactctggtgtatcc
tctgaaagtggacattactattcatatgctagaaatgtgactggttcgggttcttcagga
cagtgtcaccagtctaaagctttttctttaatttctcctcagaataaattgttagcagag
gagagtccctgtactgttatagaaaatgagctggacactgagatgccgaaagaatggttt
ttattcaatgatagcagagtgacatttacctcatttcagtcagtccagaaaattaccagt
aggtttccaaaggacactgcttatgttctgatttacaaaaaacaaaatagtacctgtggc
tacaacacaaattcagcaaatggactctgggtgaatggagaccctcccctacaaaaagac
ctcatggatgcgattacaaaagataacaaactatacttgcaggagcaagagcttagtgct
cgaacgcaagcacttcaagctgcctcagcctcgtgctctttccgccccaatggatttgat
gacaacgatcccccgggaagttgtggaccagcaggtggaggaggagggggtggattcagt
actgttggtagattagtcttttga

DBGET integrated database retrieval system