KEGG   Meleagris gallopavo (turkey): 100543704Help
Entry
100543704         CDS       T01523                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:mgp04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:mgp04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:mgp04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mgp04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mgp04110]
Cellular Processes; Cell communication; Adherens junction [PATH:mgp04520]
Organismal Systems; Endocrine system; Melanogenesis [PATH:mgp04916]
Human Diseases; Infectious diseases; Influenza A [PATH:mgp05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mgp05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2415 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMAGQTPQNSPGMGMLNS
MVKSPMAQAGLTSPSMAMGTSGPNQGPSAQSTAGMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGVMQGQVMNGSIGAGRGRPNMPYPNPGMGTAGNLLAETLQQGSPQMGGQAG
LRGPQPGAMNKMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKTGLQNSLPQFQMDKK
PVPGAGMPNMGQQQAPQVQQAGMGPAASQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNAGDKRNQQSLLGGAAVGLANTGSVGVGQQTTPSISTTSQIDPSSIERAYAALG
LTYQGNQMQTQSQAQVKNQQQGQSPQSLRPMNPMSANPMGVNGGVGVQTPSLLPDSMLHS
TMNSQNSMMSESANVASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPD
PAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQN
MIPSAPGMPQAPVNQGPNMGQPQPGMSANGPITDPTLIRANVPNQMMNRMQAQPGMNQFG
HMNMQLSSMGPRQTPPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQNPFPA
SSPGMNAASMPMTQTSSQTPVSQAQMNSSSCPVNSPAMAPGSQGSHIHCPPLPQPPMHRN
SPSPVPSRTPTPHHTPPGLGSQQQQAAAAATTVPTPTPQAMPPGPQSQTMHPPQRQTPTP
PQAQLPPQVQPPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSIDG
QVSNPPSTSSTEVNSQQTAAEQQQPPLQEVKMEIKTDEGEPEQTELQMEEKSEVTVEECK
PDPMEQEEKKTEVKTEMPEGEERPTTPATQSSPAAGQSKKKIFKPEELRQALMPTLEALY
RQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFN
NAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIP
RDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVE
CIECGRKMHQICVLHNEMIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFLENRV
NDFLKRQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEI
DGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVK
KLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDI
FKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSKGDSK
NAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAA
NSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRF
VYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTATTQS
PGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLI
ALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQG
LPSPTPATPTTPTGQQPTTPQTPQPQPPPQPASQPQPAPPNSMPPYSMPRTQPPGAVSQG
KAGGQVTPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQHQMPQM
PPMGMNPPQIARGPGGHIDQGMGPAGIQQQPPWVQGGLPQAQLQPGMQRPSMMSVAQPGQ
PMNMAPQPGMGQVPGTAQPKQPPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLLA
AFIKQRAAKYAGSQNPQGMPGQPGMPQGQPGLQPQQAMQGQQGGVHPNAAMQNMNPMQGG
VQRPSMPQQQQPPQQPQQAMAGMNPQAQQMNMNHSGMAPQFRDLLMRRHQIMEQQRQQQQ
QGVGPALGPGMANHNQFQQPQGVGYPQQQQQQQQQQRMQHHMQQMQQGNMGQISQLPQAM
SAETGASLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLTNQVR
XSPQTSSPHPGLVAAQANPMDQGHFASPDQSAMLSQLASNPGMAGLHGTSATELGLSSEN
SDLNSNLSQSTLDIH
NT seq 7248 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctcg
ccggcgctctccgtgtccgccagcgacggcacagattttggatcgctatttgatctggaa
catgacttgccagatgaactgatcagctccacagaactgggactcaccaatggtggtgac
attaatcagctgcagaccagccttggcctggcacaagatgctgcctctaaacacaagcag
ctgtcagaacttttacgggctggtagctccccaaatctcaatatgggggttggtggccct
ggccagggcatggccggccaaactccacaaaatagtcctggaatgggaatgttgaacagc
atggtgaaaagccctatggcacaggctgggttgacttctcccagtatggcgatgggtaca
agcggaccaaatcagggtccttcagcccaatctacagcaggaatgatgccaacagtaaac
agtccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaatggacagggggtgatgcaggggcaagtcatgaacggttca
attggagcaggcagagggcgaccaaatatgccatacccaaacccaggaatgggaactgct
ggtaacttgttggctgagacactgcagcaaggctctccgcagatgggaggacaggctgga
ctgagggggccgcagcctggagccatgaacaagatgggaatgatgagcaatcccagtcct
tatggtcagccatacagtcagaataccgggcagcagattggagccagtggtctcggacct
cagatgcagaataagactggactgcaaaatagcttaccacagtttcaaatggacaagaag
ccagttcctggggcaggaatgcctaacatgggtcagcagcaggctccccaagttcagcaa
gctgggatggggccagcagcttcacaaggaatggggtctggagctccaacagcagatcca
gagaaacgcaaactcattcagcaacaactagttctcctcttacacgctcacaagtgtcaa
cggcgagaacaggccaacggtgaggtgcggcagtgcaacctccctcattgccgaaccatg
aagaacgttctaaaccacatgacacattgtcaggctggcaaatcttgccaggtggcacat
tgtgcgtcttctcgacaaatcatctcgcactggaagaactgtacaagacatgactgtcct
gtatgtttgccactcaaaaatgctggggacaaaagaaaccaacaatctctactgggtgga
gctgcagtaggacttgcaaacaccggctccgtgggtgtggggcagcagactacgcccagc
ataagcactaccagtcagatagaccccagctccatcgagagagcctatgcagcccttgga
ctgacctatcaagggaaccagatgcagacacagtctcaggctcaagtgaagaatcagcag
caaggacagtcaccccagagtctgcgcccaatgaatcctatgagtgcaaatccaatgggg
gtaaatggaggagtaggagttcaaacccccagtctgctgcctgactcaatgttacattca
accatgaattcccaaaactccatgatgagtgaaagcgccaatgttgctagtctgggggct
atgccaaccgctcagccatccaatacaggaattcgaaagcagtggcatgaagatattact
caggatctccgaaatcatcttgttcataaactagtccaagccatatttcctacacctgac
cctgcagcattgaaggatcggcgtatggagaatctggtggcatatgctcggaaagtggaa
ggcgatatgtatgaatcagcaaatagcagggcggagtactatcacttgctagctgagaag
atctataagattcagaaggagctggaggaaaagcgaagaaccaggctgcagaagcaaaat
atgataccaagtgctccgggcatgccacaggctcccgtgaatcaagggcctaacatggga
cagcctcagccagggatgtctgcaaatggtcctataactgacccaacactgatacgtgct
aatgtgccaaaccagatgatgaatcgcatgcaggcacagccaggaatgaatcagtttggc
cacatgaatatgcagctgtcatcgatgggaccccggcaaacccctcctcttcagcaccct
ggacagctaagccaggccggggccatgaaccagatgggatttccttcacgtatgcaacaa
ccaggagttggccaaccttctggtcaaaatcaatttctgcagcagaacccattccctgct
tcttccccaggaatgaatgcagcaagcatgcctatgacacaaactagcagtcagacacca
gtttctcaagcacaaatgaacagctcttcctgtcctgtgaattctcctgccatggctcca
ggttctcaagggagtcatattcactgcccacctcttccacagcctcccatgcaccgaaat
tctccttcaccagtacccagtcgaaccccaacgcctcaccatacacctccaggcttggga
tcgcagcaacagcaggcagcagcagctgccaccactgtccccacccctactcctcaggca
atgccacccggaccgcagtcacaaactatgcatccccctcagaggcagactccaacacct
ccacaggcacagctgcctccacaagtccagcctccagttcctgttacgccctctgcagag
cagcagcagcaacccttgtcacagcagagtacaacggcatcggttcccacaccaacagcg
ccgctgcagcctcagcaccccacaacacctctgtcacaaccagctgtaagcattgatggg
caggtatccaaccccccatccaccagcagcacagaagtgaactctcagcagactgcagca
gagcagcagcagccacctttgcaggaagtgaaaatggagataaaaacagatgaaggggaa
ccagaacaaacagagctgcagatggaggagaaatctgaggtgacagtggaagaatgtaaa
ccagacccaatggaacaagaagagaagaaaacagaagtgaagactgaaatgccagagggg
gaggaaagacctacaactccagctactcagtcttctccagcagcaggacagtctaagaaa
aaaattttcaagccagaagagttgcggcaggcacttatgccaacactggaggcactttac
cgtcaggacccagagtctcttccatttcgacagcctgtggatccccagctactaggaatt
cctgattattttgacattgtgaagaatcccatggacctttctactatcaagaggaagcta
gacacaggacaatatcaagaaccatggcaatatgtagatgacatctggctcatgttcaat
aatgcctggctctacaaccgcaaaacatcccgggtatataagtactgctcaaaactggcc
gaggtgtttgagcaagaaattgatccagttatgcagagccttggttactgctgtggaaga
aagttggagttctcgccacagactttgtgttgctatggcaaacagctatgcacaatccct
cgagatgccacttactacagttaccagaacaggtatcatttctgtgagaagtgcttcaac
gaaatccaaggggagagcgtttctctgggagatgacccttcacaacctcaaaccacgata
aacaaagaacagttttcaaaaaggaaaaacgatacactggatcctgaactatttgttgaa
tgtatagagtgtggaagaaaaatgcaccagatctgtgttcttcacaatgagatgatctgg
ccttctggctttgtctgcgatggctgtctgaagaaaacagggcgaaccaggaaagagaac
aaattctctgctaaaaggttaccagctacaagacttggtaccttcttagagaacagagtc
aatgatttcctaaagagacagaatcacccagaggcaggagaggttacagttagggtggta
catgcgtctgacaaaactgttgaagtaaagccaggaatgaaagcaagatttgtagacagt
ggagagatggctgagtctttcccctatcgaacaaaagcactttttgcctttgaggagatt
gatggtgtagacttgtgcttctttgggatgcacgtgcaggagtatggctcagactgtccc
ccacccaatcaaaggcgagtgtatatatcttaccttgacagtgttcatttcttccgccct
aaatgcttgaggactgctgtctatcatgaaatcctaattggatatctagaatatgtcaag
aaattagggtatactactggacatatctgggcatgcccaccaagtgaaggagatgactac
attttccactgccatcctcctgaccaaaagatacccaaacccaaacgactgcaagagtgg
tacaaaaagatgctggacaaatctgtgtcagagcgcattgttcacgactacaaggatata
tttaagcaagcgacagaagaccgtctgacaagtgcgaaagagttaccttactttgaaggg
gacttctggccaaatgttctggaggagagtattaaggaactcgagcaagaggaggaagag
cgaaagagagaagagaacactagtaatgaaagcacagatgtgagcaaaggagacagcaaa
aatgccaaaaagaagaacaataagaagacaagtaagaacaagagcagtttgagtcgtggc
aataagaagaagcctggcatgccgaatgtgtccaatgacctttcccaaaagctgtatgcc
actatggagaaacacaaagaggttttctttgtcatccgtctcattgctggccctgcagcc
aactcccttccccccatcgttgagcctgacccgctcattccatgtgacctgatggatggg
cgcgatgctttccttacccttgctagagacaagcacctggagttctcctctctgcgaaga
gctcagtggtcaaccatgtgcatgctggtggagctgcatacgcagagccaagaccgcttt
gtttacacctgcaacgagtgcaagcatcatgtggagaccagatggcactgcactgtgtgt
gaggattacgacctgtgcatcacctgctataacactaagaatcacgaccataagatggaa
aaactaggccttggtctagatgatgagagcaacaaccagcagactgcaaccacccagagc
ccaggtgactcccgccgcctgagcatccagcgctgcatccagtccctggtccacgcctgc
cagtgccgtaacgccaactgctcgctgccatcctgccagaagatgaaacgggtcgtccaa
cacaccaaaggctgcaaacgcaaaaccaacggagggtgccccatctgcaagcaactcatt
gctctttgctgctaccatgcaaagcactgccaggagaacaagtgcccggtgcccttctgc
ctcaacatcaaacacaaactccgtcaacagcagcttcagcaccgcctgcaacaggctcag
atgctccgaaggaggatggcaagtatgcagcggaccggtgtggtgggccagcagcagggg
ctgccctcaccgacaccagccaccccgacaactccgacaggccagcagcccacgacgccg
caaactccccagccccagcctccaccccaacctgcctcgcagcctcagcccgcgcctccc
aacagcatgccgccctacagcatgccgagaactcaaccccctggtgctgtgtcccagggc
aaggcgggcggccaggtgactcctccgactccaccccagccgcctcagccaccagttcag
ggtcctcctccagcagcggtggaaatggccatgcagatccagagggcggcggagacccaa
cgacagatggcgcaggttcagattttccaaaggccgattcagcaccagatgccccagatg
ccgcccatgggaatgaatcctccacagatagccaggggtcctggtggccacatagatcaa
ggaatggggccagcggggatccaacagcagccaccttgggtgcagggtggcttgccccaa
gctcagctgcagccgggaatgcagaggccatccatgatgtcagtagcccagccaggtcaa
ccaatgaatatggcacctcagccaggaatgggccaggtacctggcactgcccagccaaag
cagccacctctgccccaggcagccttacagaacctactgcggacactcaggtctcccagc
tcacccatgcagcagcagcaggtgcttaacatccttcactccaatcctcagctgttggct
gctttcatcaagcagcgggccgccaagtacgcggggtcccagaacccccaggggatgcct
ggtcaacctggcatgccccagggccagccggggctccaaccgcagcaggccatgcagggg
cagcagggaggggtgcaccccaacgcagccatgcagaacatgaaccccatgcaggggggg
gtgcagaggcccagcatgccacagcagcagcagccgccacagcagccgcagcaagccatg
gctgggatgaatcctcaggcacagcagatgaatatgaatcactcggggatggctcctcag
ttccgagacctcctgatgcggcggcaccagataatggagcagcagcgccagcagcagcag
caaggagtgggaccggcgctggggccagggatggccaaccacaaccagttccagcagccc
cagggcgtcgggtatccacagcagcagcagcaacagcagcagcagcaacggatgcagcat
cacatgcaacagatgcagcaaggaaacatgggacagataagccagcttccccaggccatg
agtgcagagacaggagccagtttgcagcaggctttccagcagaggctgctccagcagcag
atggggtccccggctcagcccaatcctatgagcccccagcagcacatgctgcccaaccag
gcccagtccccacacctacagggtcagcagctcccttcgtcgctcaccaatcaagtgcgc
ntctccccgcagaccagctccccacatccaggactggtagctgcacaggctaatcccatg
gatcaagggcactttgccagcccggaccagagtgcaatgctttcccagcttgctagcaat
cctggtatggcaggcctccatggtacaagcgccacagaactggggctcagctctgagaac
tcagacttgaattcaaatctttcacagagtacactagacatacactag

DBGET integrated database retrieval system