KEGG   Meleagris gallopavo (turkey): 100543704Help
Entry
100543704         CDS       T01523                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100543704 (EP300)
   04330 Notch signaling pathway
    100543704 (EP300)
   04350 TGF-beta signaling pathway
    100543704 (EP300)
   04630 Jak-STAT signaling pathway
    100543704 (EP300)
   04068 FoxO signaling pathway
    100543704 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100543704 (EP300)
  Cellular commiunity
   04520 Adherens junction
    100543704 (EP300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100543704 (EP300)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100543704 (EP300)
   05168 Herpes simplex infection
    100543704 (EP300)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100543704 (EP300)
Transcription factors [BR:mgp03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100543704 (EP300)
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100543704 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2408 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMAGQTPQNSPGMGMLNS
MVKSPMAQAGLTSPSMAMGTSGPNQGPSAQSTAGMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGVMQGQVMNGSIGAGRGRPNMPYPNPGMGTAGNLLAETLQQGSPQMGGQAG
LRGPQPGAMNKMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKTGLQNSLPQFQMDKK
PVPGAGMPNMGQQQAPQVQQAGMGPAASQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNAGDKRNQQSLLGGAAVGLANTGSVGVGQQTTPSISTTSQIDPSSIERAYAALG
LTYQGNQMQTQSQAQVKNQQQGQSPQSLRPMNPMSANPMGVNGGVGVQTPSLLPDSMLHS
TMNSQNSMMSESANVASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPD
PAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQN
MIPSAPGMPQAPVNQGPNMGQPQPGMSANGPITDPTLIRANVPNQMMNRMQAQPGMNQFG
HMNMQLSSMGPRQTPPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQNPFPA
SSPGMNAASMPMTQTSSQTPVSQAQMNSSSCPVNSPAMAPGSQGSHIHCPPLPQPPMHRN
SPSPVPSRTPTPHHTPPGLGSQQQQAAAAATTVPTPTPQAMPPGPQSQTMHPPQRQTPTP
PQAQLPPQVQPPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSIDG
QVSNPPSTSSTEVNSQQTAAEQQQPPLQEVKMEIKTDEGEPEQTELQMEEKSEVKVEPAV
EECKPDPMEQEEKKTEVKTEMPEGEERPTTPATQSSPAAGQSKKKIFKPEELRQALMPTL
EALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIW
LMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQL
CTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPE
LFVECIECGRKMHQICVLHNEMIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFL
ENRVNDFLKRQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFA
FEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYL
EYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHD
YKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSK
GDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIA
GPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQS
QDRFVYTCNECKHHVETRWHCTVCEISILGIQRCIQSLVHACQCRNANCSLPSCQKMKRV
VQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQ
AQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPQPPPQPASQPQPA
PPNSMPPYSMPRTQPPGAVSQGKAGGQVTPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAE
TQRQMAQVQIFQRPIQHQMPQMPPMGMNPPQIARGPGGHIDQGMGPAGIQQQPPWVQGGL
PQAQLQPGMQRPSMMSVAQPGQPMNMAPQPGMGQVPGTAQPKQPPLPQAALQNLLRTLRS
PSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYAGSQNPQGMPGQPGMPQGQPGLQPQQAM
QGQQGGVHPNAAMQNMNPMQGGVQRPSMPQQQQPPQQPQQAMAGMNPQAQQMNMNHSGMA
PQFRDLLMRRHQIMEQQRQQQQQGVGPALGPGMANHNQFQQPQGVGYPQQQQQQQQQQRM
QHHMQQMQQGNMGQISQLPQAMSAETGASLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLP
NQAQSPHLQGQQLPSSLTNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSS
PHPGLVAAQANPMDQGHFASPDQSAMLSQLASNPGMAGLHGTSATELGLSSENSDLNSNL
SQSTLDIH
NT seq 7227 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctcg
ccggcgctctccgtgtccgccagcgacggcacagattttggatcgctatttgatctggaa
catgacttgccagatgaactgatcagctccacagaactgggactcaccaatggtggtgac
attaatcagctgcagaccagccttggcctggcacaagatgctgcctctaaacacaagcag
ctgtcagaacttttacgggctggtagctccccaaatctcaatatgggggttggtggccct
ggccagggcatggccggccaaactccacaaaatagtcctggaatgggaatgttgaacagc
atggtgaaaagccctatggcacaggctgggttgacttctcccagtatggcgatgggtaca
agcggaccaaatcagggtccttcagcccaatctacagcaggaatgatgccaacagtaaac
agtccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaatggacagggggtgatgcaggggcaagtcatgaacggttca
attggagcaggcagagggcgaccaaatatgccatacccaaacccaggaatgggaactgct
ggtaacttgttggctgagacactgcagcaaggctctccgcagatgggaggacaggctgga
ctgagggggccgcagcctggagccatgaacaagatgggaatgatgagcaatcccagtcct
tatggtcagccatacagtcagaataccgggcagcagattggagccagtggtctcggacct
cagatgcagaataagactggactgcaaaatagcttaccacagtttcaaatggacaagaag
ccagttcctggggcaggaatgcctaacatgggtcagcagcaggctccccaagttcagcaa
gctgggatggggccagcagcttcacaaggaatggggtctggagctccaacagcagatcca
gagaaacgcaaactcattcagcaacaactagttctcctcttacacgctcacaagtgtcaa
cggcgagaacaggccaacggtgaggtgcggcagtgcaacctccctcattgccgaaccatg
aagaacgttctaaaccacatgacacattgtcaggctggcaaatcttgccaggtggcacat
tgtgcgtcttctcgacaaatcatctcgcactggaagaactgtacaagacatgactgtcct
gtatgtttgccactcaaaaatgctggggacaaaagaaaccaacaatctctactgggtgga
gctgcagtaggacttgcaaacaccggctccgtgggtgtggggcagcagactacgcccagc
ataagcactaccagtcagatagaccccagctccatcgagagagcctatgcagcccttgga
ctgacctatcaagggaaccagatgcagacacagtctcaggctcaagtgaagaatcagcag
caaggacagtcaccccagagtctgcgcccaatgaatcctatgagtgcaaatccaatgggg
gtaaatggaggagtaggagttcaaacccccagtctgctgcctgactcaatgttacattca
accatgaattcccaaaactccatgatgagtgaaagcgccaatgttgctagtctgggggct
atgccaaccgctcagccatccaatacaggaattcgaaagcagtggcatgaagatattact
caggatctccgaaatcatcttgttcataaactagtccaagccatatttcctacacctgac
cctgcagcattgaaggatcggcgtatggagaatctggtggcatatgctcggaaagtggaa
ggcgatatgtatgaatcagcaaatagcagggcggagtactatcacttgctagctgagaag
atctataagattcagaaggagctggaggaaaagcgaagaaccaggctgcagaagcaaaat
atgataccaagtgctccgggcatgccacaggctcccgtgaatcaagggcctaacatggga
cagcctcagccagggatgtctgcaaatggtcctataactgacccaacactgatacgtgct
aatgtgccaaaccagatgatgaatcgcatgcaggcacagccaggaatgaatcagtttggc
cacatgaatatgcagctgtcatcgatgggaccccggcaaacccctcctcttcagcaccct
ggacagctaagccaggccggggccatgaaccagatgggatttccttcacgtatgcaacaa
ccaggagttggccaaccttctggtcaaaatcaatttctgcagcagaacccattccctgct
tcttccccaggaatgaatgcagcaagcatgcctatgacacaaactagcagtcagacacca
gtttctcaagcacaaatgaacagctcttcctgtcctgtgaattctcctgccatggctcca
ggttctcaagggagtcatattcactgcccacctcttccacagcctcccatgcaccgaaat
tctccttcaccagtacccagtcgaaccccaacgcctcaccatacacctccaggcttggga
tcgcagcaacagcaggcagcagcagctgccaccactgtccccacccctactcctcaggca
atgccacccggaccgcagtcacaaactatgcatccccctcagaggcagactccaacacct
ccacaggcacagctgcctccacaagtccagcctccagttcctgttacgccctctgcagag
cagcagcagcaacccttgtcacagcagagtacaacggcatcggttcccacaccaacagcg
ccgctgcagcctcagcaccccacaacacctctgtcacaaccagctgtaagcattgatggg
caggtatccaaccccccatccaccagcagcacagaagtgaactctcagcagactgcagca
gagcagcagcagccacctttgcaggaagtgaaaatggagataaaaacagatgaaggggaa
ccagaacaaacagagctgcagatggaggagaaatctgaggttaaagtagaaccagcagtg
gaagaatgtaaaccagacccaatggaacaagaagagaagaaaacagaagtgaagactgaa
atgccagagggggaggaaagacctacaactccagctactcagtcttctccagcagcagga
cagtctaagaaaaaaattttcaagccagaagagttgcggcaggcacttatgccaacactg
gaggcactttaccgtcaggacccagagtctcttccatttcgacagcctgtggatccccag
ctactaggaattcctgattattttgacattgtgaagaatcccatggacctttctactatc
aagaggaagctagacacaggacaatatcaagaaccatggcaatatgtagatgacatctgg
ctcatgttcaataatgcctggctctacaaccgcaaaacatcccgggtatataagtactgc
tcaaaactggccgaggtgtttgagcaagaaattgatccagttatgcagagccttggttac
tgctgtggaagaaagttggagttctcgccacagactttgtgttgctatggcaaacagcta
tgcacaatccctcgagatgccacttactacagttaccagaacaggtatcatttctgtgag
aagtgcttcaacgaaatccaaggggagagcgtttctctgggagatgacccttcacaacct
caaaccacgataaacaaagaacagttttcaaaaaggaaaaacgatacactggatcctgaa
ctatttgttgaatgtatagagtgtggaagaaaaatgcaccagatctgtgttcttcacaat
gagatgatctggccttctggctttgtctgcgatggctgtctgaagaaaacagggcgaacc
aggaaagagaacaaattctctgctaaaaggttaccagctacaagacttggtaccttctta
gagaacagagtcaatgatttcctaaagagacagaatcacccagaggcaggagaggttaca
gttagggtggtacatgcgtctgacaaaactgttgaagtaaagccaggaatgaaagcaaga
tttgtagacagtggagagatggctgagtctttcccctatcgaacaaaagcactttttgcc
tttgaggagattgatggtgtagacttgtgcttctttgggatgcacgtgcaggagtatggc
tcagactgtcccccacccaatcaaaggcgagtgtatatatcttaccttgacagtgttcat
ttcttccgccctaaatgcttgaggactgctgtctatcatgaaatcctaattggatatcta
gaatatgtcaagaaattagggtatactactggacatatctgggcatgcccaccaagtgaa
ggagatgactacattttccactgccatcctcctgaccaaaagatacccaaacccaaacga
ctgcaagagtggtacaaaaagatgctggacaaatctgtgtcagagcgcattgttcacgac
tacaaggatatatttaagcaagcgacagaagaccgtctgacaagtgcgaaagagttacct
tactttgaaggggacttctggccaaatgttctggaggagagtattaaggaactcgagcaa
gaggaggaagagcgaaagagagaagagaacactagtaatgaaagcacagatgtgagcaaa
ggagacagcaaaaatgccaaaaagaagaacaataagaagacaagtaagaacaagagcagt
ttgagtcgtggcaataagaagaagcctggcatgccgaatgtgtccaatgacctttcccaa
aagctgtatgccactatggagaaacacaaagaggttttctttgtcatccgtctcattgct
ggccctgcagccaactcccttccccccatcgttgagcctgacccgctcattccatgtgac
ctgatggatgggcgcgatgctttccttacccttgctagagacaagcacctggagttctcc
tctctgcgaagagctcagtggtcaaccatgtgcatgctggtggagctgcatacgcagagc
caagaccgctttgtttacacctgcaacgagtgcaagcatcatgtggagaccagatggcac
tgcactgtgtgtgagatttctatacttggcatccagcgctgcatccagtccctggtccac
gcctgccagtgccgtaacgccaactgctcgctgccatcctgccagaagatgaaacgggtc
gtccaacacaccaaaggctgcaaacgcaaaaccaacggagggtgccccatctgcaagcaa
ctcattgctctttgctgctaccatgcaaagcactgccaggagaacaagtgcccggtgccc
ttctgcctcaacatcaaacacaaactccgtcaacagcagcttcagcaccgcctgcaacag
gctcagatgctccgaaggaggatggcaagtatgcagcggaccggtgtggtgggccagcag
caggggctgccctcaccgacaccagccaccccgacaactccgacaggccagcagcccacg
acgccgcaaactccccagccccagcctccaccccaacctgcctcgcagcctcagcccgcg
cctcccaacagcatgccgccctacagcatgccgagaactcaaccccctggtgctgtgtcc
cagggcaaggcgggcggccaggtgactcctccgactccaccccagccgcctcagccacca
gttcagggtcctcctccagcagcggtggaaatggccatgcagatccagagggcggcggag
acccaacgacagatggcgcaggttcagattttccaaaggccgattcagcaccagatgccc
cagatgccgcccatgggaatgaatcctccacagatagccaggggtcctggtggccacata
gatcaaggaatggggccagcggggatccaacagcagccaccttgggtgcagggtggcttg
ccccaagctcagctgcagccgggaatgcagaggccatccatgatgtcagtagcccagcca
ggtcaaccaatgaatatggcacctcagccaggaatgggccaggtacctggcactgcccag
ccaaagcagccacctctgccccaggcagccttacagaacctactgcggacactcaggtct
cccagctcacccatgcagcagcagcaggtgcttaacatccttcactccaatcctcagctg
ttggctgctttcatcaagcagcgggccgccaagtacgcggggtcccagaacccccagggg
atgcctggtcaacctggcatgccccagggccagccggggctccaaccgcagcaggccatg
caggggcagcagggaggggtgcaccccaacgcagccatgcagaacatgaaccccatgcag
gggggggtgcagaggcccagcatgccacagcagcagcagccgccacagcagccgcagcaa
gccatggctgggatgaatcctcaggcacagcagatgaatatgaatcactcggggatggct
cctcagttccgagacctcctgatgcggcggcaccagataatggagcagcagcgccagcag
cagcagcaaggagtgggaccggcgctggggccagggatggccaaccacaaccagttccag
cagccccagggcgtcgggtatccacagcagcagcagcaacagcagcagcagcaacggatg
cagcatcacatgcaacagatgcagcaaggaaacatgggacagataagccagcttccccag
gccatgagtgcagagacaggagccagtttgcagcaggctttccagcagaggctgctccag
cagcagatggggtccccggctcagcccaatcctatgagcccccagcagcacatgctgccc
aaccaggcccagtccccacacctacagggtcagcagctcccttcgtcgctcaccaatcaa
gtgcgctctccacagcctgtaccctcgccacggccccagtcccagcccccccattccagc
ccatccccccggatgcagcctcagccttctccgcaccacgtctccccgcagaccagctcc
ccacatccaggactggtagctgcacaggctaatcccatggatcaagggcactttgccagc
ccggaccagagtgcaatgctttcccagcttgctagcaatcctggtatggcaggcctccat
ggtacaagcgccacagaactggggctcagctctgagaactcagacttgaattcaaatctt
tcacagagtacactagacatacactag

DBGET integrated database retrieval system