KEGG   Meleagris gallopavo (turkey): 100543715Help
Entry
100543715         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 46-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 578 aa AA seqDB search
MATYRHRHARLQPQHGHGSGRRDGERPEPRRASGDLVGTSGRSCGRREKSAREGMEGAVG
RRERTRSERANVKGRRDVGPTRPRPTGTSLPSLHTTRPSCERNAGRTPYRLTAGRRGKRA
GCASAAFKYRPPLPRDPREPNVSGEGGEGEPEARVPPPPIGRAGARDWRRCTAPHQTGSG
VCVRFSVSLGLEEGSGPLSQERARACRASVGTWLLGSARMTAARGTNASALEKDIGPEQF
PINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLSYKAQQKKKENLLTCLADLFHSIA
TQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGK
LKNGNMNEAEENNKQELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSI
THCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYT
KLSYRVVFPLELRLFNTSGDAVNLDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFD
DDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggccacctaccggcatcggcacgcgcggctccagccccagcacggccacggcagcggc
cgccgggacggggagcgaccagagccccggagggcatcgggagaccttgtggggacctcg
ggccggagctgcggaaggagagagaagtcagcacgggagggaatggaaggagccgtggga
cggagggaaaggacgcgctccgagagggcaaatgtgaagggaagacgcgatgtaggtccc
acccgccctcggcccaccggcacgagcctccccagccttcacaccacccgcccctcatgc
gagaggaacgccgggaggacaccttaccgcctcaccgccgggcggcggggaaagagggcg
ggctgtgcctccgcggcctttaaataccgccctccgctcccgcgagatccgcgagagccc
aacgtctctggagaaggtggggagggggagccagaggcacgggtgccgccgccgcctatt
ggtcgagcaggagcacgtgactggaggcggtgtaccgcccctcaccagacgggcagcgga
gtatgcgtgcggttctcggtgtcgctggggctcgaggagggctccgggcctctcagtcag
gagcgggcgagggcctgtagggcttctgtcgggacatggctgctcggctctgctcggatg
acagctgcacggggcaccaatgcctctgctctggaaaaagacattggcccagagcagttt
cccatcaatgaacactactttggattggtcaattttgggaacacctgctactgtaactcc
gtgctgcaggcactgtacttttgccggccatttcgggaaaatgttttatcatacaaggcc
caacagaaaaagaaggaaaatctcttgacttgcctggcagatctttttcacagtattgct
actcagaagaagaaagttggagttattccaccgaagaagttcatatcaaggttacgaaaa
gagaatgatctctttgacaactacatgcagcaggatgcacatgagtttttaaattacttg
ctgaatacaatcgccgacattttacaggaggagaagaaacaggaaaagcaaaatgggaaa
ttgaaaaatggcaacatgaacgaagctgaagagaacaataagcaagaactcacctgggtg
catgagatttttcagggaacactgactaacgaaactagatgtttgaactgtgaaaccgtt
agtagtaaagatgaagattttcttgacctttctgttgatgtggagcagaacacatcaatt
acacactgtctaagagacttcagtaacacagaaacattatgtagtgagcagaaatactac
tgtgaaacctgctgcagtaaacaagaggcacagaaaaggatgcgagtaaaaaagttgcca
atgattcttgccttacacctcaagagattcaagtacatggagcaattgcacaggtatact
aagctgtcttatcgtgttgtatttcccctggaattacgtctcttcaacacatctggtgac
gctgtcaacttagaccggatgtatgacttagtagctgttgtcgttcactgtggaagtgga
ccgaatcgtgggcattatatcactattgtgaaaagtcatggattttggctcttgtttgat
gatgacattgtagagaaaatagatgctcaagctattgaagaattttatggactgacctct
gatatatcaaaaaattcggagtctggttatattttattctaccagtcaagagagtga

DBGET integrated database retrieval system