KEGG   Meleagris gallopavo (turkey): 100543802Help
Entry
100543802         CDS       T01523                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mgp04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mgp04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mgp04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:mgp04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
29
AA seq 882 aa AA seqDB search
MRSTHRPRGRRRPSRCPPSPAASHAANAHAQYGALTSARHARTYGQVTSIVVLLVVDQAA
IWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQC
KYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRL
AKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCLPNTCTTLVSNH
NISHRQPETVLMETPQDTIELNRINLESSNAKYSSLNTDSSMSYIDSAVISPDAVPLGSG
TAILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNSSSVIDV
PSTGAPSKKAVTRISQAGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTTPQVLSPTIAA
PPNSLPRRSSRLFTSDSSTTKENSKKLKMKFPPKIANRKTKSKTNKGGITQPNINDSLEI
TKLDSSIISEGKISTVTPQIQAFTLQKAAAGLMSLLRDMGKGYLALCSYNCKEAINILSH
LPSHHYNTGWVLCQIGRAYFELAEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDV
ALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHE
FVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSV
LLCHIGVVQHALKKSEKALDTLNKAINIDPKNPLCKFHRASVLFANEKYKSALQELEELK
QIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEP
ITQEEQISECYPYESVGTDESQESSMTDADDTQLHAVESDEF
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtacgcaccgtccccgaggccgccggcggccctcgcgttgcccgccttcgcct
gcggcttcacacgccgctaatgcgcatgctcagtacggcgcgctgacgtcagcgcggcac
gcacgcacgtacgggcaagtgacatcaattgtggtgcttcttgtagttgatcaggctgct
atatggcaagcacttaaccactatgcttaccgcgacgcagtgttcctcgcagaaaggtta
tatgcagaagtacattcagaagaagcactgtttttgctggcaacgtgttactaccgctca
ggaaaggcatataaagcatacaggctcctaaagggacacagctgtactactccacagtgt
aaatacctgcttgcaaaatgttgtgttgacctcagcaagcttgcagaaggagagcagatc
ttatctggtggagtgttgaataaacagaaaagccatgatgacattgtcacggagttcggt
gactctgcgtgctttacgctctccttactgggacatgtctactgcaagacagaccggctt
gccaaaggatcagaatgttaccaaaagagccttagtttaaatcctttcctctggtcccct
tttgaatcgctgtgtgaaataggtgaaaaaccagaccccgaccaaacgtttaaattaaca
tctttacagaacttcagcagctgtctgcctaacacttgcacaacgttggtgtctaatcac
aacatatcccacagacagcctgagactgtcctgatggaaacgccgcaagacacaattgag
ttgaacaggatcaacctagaatcctccaatgcaaaatattcctccttgaacacagattcc
tctatgtcttacattgactcagctgtaatttcaccagatgctgtccctcttgggtcagga
actgccatcttgtcaaaacaggctcaaaataaaccaaaaactgggcgaagtttactggga
ggacctgctgctttgagcccactaactccaagctttggaattttgccactagaaacccca
agccctggagatggatcctatttacaaaactacacaaactcttcttctgtaattgatgtg
ccatccacaggagcaccttcaaagaaggcggtcaccaggatcagccaggctggaacaaaa
tcagtcttctcccagagtggaaatagccgggaggtcactccaatcctcgttgcacaaaca
cagagctctggtccacagacaagtacaacacctcaggtattgagcccaacaattgctgct
ccaccaaactcactgcctcgaagaagctctcgcctttttactagtgatagctccacaaca
aaggaaaatagcaaaaaattaaaaatgaagtttccacctaagattgcaaacaggaaaaca
aaaagtaaaacaaataagggagggataactcagccaaacataaatgatagcttggaaatt
acgaaactggactcttctatcatttcagaagggaaaatatctactgttacaccacagatc
caggcttttacgctacagaaggcagcagcaggtttgatgagccttcttcgtgacatgggg
aaaggttacttagccttgtgctcttacaactgcaaagaagcgatcaatattttaagccat
ttgccctctcaccactacaacactggctgggtgctgtgccaaattgggagagcttacttt
gaactcgcagaatacatgcaggctgaaaggatattttcagaagtgaggaggattgaaaac
tacagagtagaaggcatggagatctattcaactacgctgtggcatctgcagaaagatgtt
gccctttcagttctttcaaaggatttaacagacatggataaaaactcaccagaggcgtgg
tgtgctgcagggaactgcttcagtttgcaacgagagcatgacattgcaatcaagttcttc
cagagagccattcaagttgatccaaactatgcttacgcctacacccttttggggcacgaa
tttgtgttaacagaagagctagacaaagcactagcttgttttaggaacgcaatcagagtc
aatcctagacactataatgcatggtatgggttgggaatgatttattacaaacaggaaaaa
ttcagtttagcagaaatgcatttccagaaagcacttgatatcaatcctcagagctcagtc
ttactgtgtcacattggagtagtacaacacgcactgaaaaaatctgaaaaggctttggat
actctaaacaaagctattaacattgaccccaagaacccactatgcaaattccatagggct
tctgtattgtttgcaaatgagaagtacaagtctgctttacaagaacttgaagaactgaaa
cagattgttcccaaagagtctcttgtttacttcttaataggaaaggtttataaaaagctg
ggtcaaactcatttggccctaatgaatttctcatgggcaatggacttagatcccaaagga
gccaacaaccaaattaaagaggctattgataaacgttaccttccagatgatgaggagcca
ataactcaagaagagcaaatcagtgaatgttatccctacgaatcagttggcacagacgaa
tcccaagagagcagcatgacggatgcagatgacacacagctccatgcagttgaaagtgat
gaattttaa

DBGET integrated database retrieval system