KEGG   Meleagris gallopavo (turkey): 100543802Help
Entry
100543802         CDS       T01523                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle 27
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100543802 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100543802 (CDC27)
   04114 Oocyte meiosis
    100543802 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100543802 (CDC27)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100543802 (CDC27)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100543802 (CDC27)
Chromosome [BR:mgp03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100543802 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
29
AA seq 834 aa AA seqDB search
MVFSLSHLKAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHNISHRQPETVLMETPQDTIELNRINLESSNAKYSSLNTDSSMSYIDSAV
ISPDAVPLGSGTAILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
NYTNSSSVIDVPSTGAPSKKAVTRISQAGTKSVFSQSGNSREVTPILVAQTQSSGPQTST
TPQVLSPTIAAPPNSLPRRSSRLFTSDSSTTKENSKKLKMKFPPKIANRKTKSKTNKGGI
TQPNINDSLEITKLDSSIISEGKISTVTPQIQAFTLQKAAAEGLMSLLRDMGKGYLALCS
YNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYMQAERIFSEVRRIENYRVEGMEI
YSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDP
NYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHF
QKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAINIDPKNPLCKFHRASVLFANEK
YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEA
IDKRYLPDDEEPITQEEQISECYPYESVGTDESQESSMTDADDTQLHAVESDEF
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggttttcagtttgtcacacctcaaggctgctatatggcaagcacttaaccactatgct
taccgcgacgcagtgttcctcgcagaaaggttatatgcagaagtacattcagaagaagca
ctgtttttgctggcaacgtgttactaccgctcaggaaaggcatataaagcatacaggctc
ctaaagggacacagctgtactactccacagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggagagcagatcttatctggtggagtgttgaataaacag
aaaagccatgatgacattgtcacggagttcggtgactctgcgtgctttacgctctcctta
ctgggacatgtctactgcaagacagaccggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccttttgaatcgctgtgtgaaataggtgaa
aaaccagaccccgaccaaacgtttaaattaacatctttacagaacttcagcagctgtctg
cctaacacttgcacaacgttggtgtctaatcacaacatatcccacagacagcctgagact
gtcctgatggaaacgccgcaagacacaattgagttgaacaggatcaacctagaatcctcc
aatgcaaaatattcctccttgaacacagattcctctatgtcttacattgactcagctgta
atttcaccagatgctgtccctcttgggtcaggaactgccatcttgtcaaaacaggctcaa
aataaaccaaaaactgggcgaagtttactgggaggacctgctgctttgagcccactaact
ccaagctttggaattttgccactagaaaccccaagccctggagatggatcctatttacaa
aactacacaaactcttcttctgtaattgatgtgccatccacaggagcaccttcaaagaag
gcggtcaccaggatcagccaggctggaacaaaatcagtcttctcccagagtggaaatagc
cgggaggtcactccaatcctcgttgcacaaacacagagctctggtccacagacaagtaca
acacctcaggtattgagcccaacaattgctgctccaccaaactcactgcctcgaagaagc
tctcgcctttttactagtgatagctccacaacaaaggaaaatagcaaaaaattaaaaatg
aagtttccacctaagattgcaaacaggaaaacaaaaagtaaaacaaataagggagggata
actcagccaaacataaatgatagcttggaaattacgaaactggactcttctatcatttca
gaagggaaaatatctactgttacaccacagatccaggcttttacgctacagaaggcagca
gcagaaggtttgatgagccttcttcgtgacatggggaaaggttacttagccttgtgctct
tacaactgcaaagaagcgatcaatattttaagccatttgccctctcaccactacaacact
ggctgggtgctgtgccaaattgggagagcttactttgaactcgcagaatacatgcaggct
gaaaggatattttcagaagtgaggaggattgaaaactacagagtagaaggcatggagatc
tattcaactacgctgtggcatctgcagaaagatgttgccctttcagttctttcaaaggat
ttaacagacatggataaaaactcaccagaggcgtggtgtgctgcagggaactgcttcagt
ttgcaacgagagcatgacattgcaatcaagttcttccagagagccattcaagttgatcca
aactatgcttacgcctacacccttttggggcacgaatttgtgttaacagaagagctagac
aaagcactagcttgttttaggaacgcaatcagagtcaatcctagacactataatgcatgg
tatgggttgggaatgatttattacaaacaggaaaaattcagtttagcagaaatgcatttc
cagaaagcacttgatatcaatcctcagagctcagtcttactgtgtcacattggagtagta
caacacgcactgaaaaaatctgaaaaggctttggatactctaaacaaagctattaacatt
gaccccaagaacccactatgcaaattccatagggcttctgtattgtttgcaaatgagaag
tacaagtctgctttacaagaacttgaagaactgaaacagattgttcccaaagagtctctt
gtttacttcttaataggaaaggtttataaaaagctgggtcaaactcatttggccctaatg
aatttctcatgggcaatggacttagatcccaaaggagccaacaaccaaattaaagaggct
attgataaacgttaccttccagatgatgaggagccaataactcaagaagagcaaatcagt
gaatgttatccctacgaatcagttggcacagacgaatcccaagagagcagcatgacggat
gcagatgacacacagctccatgcagttgaaagtgatgaattttaa

DBGET integrated database retrieval system