KEGG   Meleagris gallopavo (turkey): 100543845Help
Entry
100543845         CDS       T01523                                 

Gene name
MAPK1
Definition
mitogen-activated protein kinase 1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Salmonella infection
Influenza A
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100543845 (MAPK1)
   04012 ErbB signaling pathway
    100543845 (MAPK1)
   04350 TGF-beta signaling pathway
    100543845 (MAPK1)
   04370 VEGF signaling pathway
    100543845 (MAPK1)
   04068 FoxO signaling pathway
    100543845 (MAPK1)
   04150 mTOR signaling pathway
    100543845 (MAPK1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100543845 (MAPK1)
  Cell growth and death
   04114 Oocyte meiosis
    100543845 (MAPK1)
  Cellular commiunity
   04510 Focal adhesion
    100543845 (MAPK1)
   04520 Adherens junction
    100543845 (MAPK1)
   04540 Gap junction
    100543845 (MAPK1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100543845 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100543845 (MAPK1)
  Endocrine system
   04910 Insulin signaling pathway
    100543845 (MAPK1)
   04912 GnRH signaling pathway
    100543845 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100543845 (MAPK1)
   04916 Melanogenesis
    100543845 (MAPK1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100543845 (MAPK1)
   04270 Vascular smooth muscle contraction
    100543845 (MAPK1)
  Development
   04320 Dorso-ventral axis formation
    100543845 (MAPK1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100543845 (MAPK1)
   05164 Influenza A
    100543845 (MAPK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100543845 (MAPK1)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100543845 (MAPK1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100543845 (MAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 375 aa AA seqDB search
MTWGGSLSTGDGAFSSHKSGGCSEKGPLRVPCIALLPASLQGVPALCHRWLRTQSSAYDN
VNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQ
DLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKI
CDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNR
PIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPK
ALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKE
LIFEETARFQPGYRS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacttggggcgggtctctgagcacaggtgatggggcgttcagcagtcacaagagtgga
ggctgctctgagaagggcccgctgcgtgttccttgcatcgcactcctgcctgcttccctg
cagggagtgcctgcattgtgccacaggtggctcaggactcagagttctgcctacgataac
gtcaacaaagttcgagttgctataaagaaaatcagtccttttgagcatcagacatactgc
cagagaactctgagagagataaagatcttactgcgcttcaggcatgagaatattatcgga
ataaatgatattatcagagctccaactattgaacaaatgaaagatgtatacattgtgcaa
gaccttatggaaacagatctttacaagctcttaaagactcaacacctcagcaacgaccac
atttgttatttcctttaccagattctgagagggttaaaatatatccattctgccaatgtg
cttcatcgtgacctcaaaccttcgaatttgctgctcaataccacttgtgatctcaagatt
tgtgacttcggactggctcgtgttgcagatcctgaccatgatcacacaggattcctgaca
gagtatgtggccacgcgttggtacagggctcctgaaatcatgctgaattctaagggttac
accaagtctattgacatctggtcagtaggctgcattctggcagagatgctctccaacaga
cccatctttccaggaaaacactaccttgaccaacttaaccatatccttggtatacttgga
tccccttcccaagaagatttgaactgtataataaatttaaaagccagaaactatttgctt
tccctaccacacaaaaataaggtaccatggaacaggctgtttccgaacgctgaccccaaa
gcacttgatttgttggataaaatgttgacctttaatcctcacaagcgaattgaagtggaa
caagctttagcccatccatatctggaacagtattatgatccaagtgatgagcctgtagct
gaagcacccttcaagtttgatatggaattggatgacttgccgaaggaaaagctgaaagaa
ctgatttttgaggaaactgctagattccagccaggatatcgatcttaa

DBGET integrated database retrieval system