KEGG   Meleagris gallopavo (turkey): 100543932Help
Entry
100543932         CDS       T01523                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100543932 (KAT2B)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100543932 (KAT2B)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100543932 (KAT2B)
Chromosome [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100543932 (KAT2B)
   HAT complexes
    PCAF complex
     100543932 (KAT2B)
    STAGA complex
     100543932 (KAT2B)
    TFTC complex
     100543932 (KAT2B)
    SAGA complex
     100543932 (KAT2B)
    SLIK complex
     100543932 (KAT2B)
    ADA-HAT complex
     100543932 (KAT2B)
    HAT-A2 complex
     100543932 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 742 aa AA seqDB search
TLLVDTPLIWFQAEESCKCNGWKNPNPPPTPPRADLQQAVVSLTEPCRSCSHTLAAHVSH
LENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVIEGS
LESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRS
PNDDIAGYKVNYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQE
KDKLPQEKRTLILTHFPKFLSMLEEEVYSPNSPIWDQDFMVSTSRTGQLGIQTVINPPPV
ARSVSYCASPSSLEQPNSGNMSPACKVSSVLDPNLGEKRKNNEPYSLEDSKRPRVVGDIP
IELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKK
IMMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTE
IVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPK
AKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC
FKDGVRQIPIESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKTILQQVKSHQSAWPFME
PVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYY
KCANILEKFFYTKIKEAGLIDK
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
actctattggttgatactcctttaatttggtttcaggctgaggagtcgtgtaaatgcaat
ggctggaagaaccccaacccacctcccacaccccctcgggcagacctgcaacaggcagtt
gtgagccttactgagccgtgccgcagctgcagtcacacactagctgctcatgtttcccac
ctggagaatgtgtctgaagaagaaatgaataggctgctggggattgtactggatgtggag
tatctgttcacctgtgtccataaagaagaagatgcagacaccaagcaagtttatttctac
ctgttcaaacttttgaggaagtgcattttacagatgggaaaacctgttattgaaggatct
ttggaaagtcccccatttgagaagcctagcattgagcagggtgtgaataattttgtgcag
tacaaatttagccacttaccctcaaaggaaaggcagacaatagtggaactggctaaaatg
tttctgaaccgcattaactattggcacctggagacaccttctcaacgaagactaagatca
cccaatgatgatattgcagggtataaagtgaattataccaggtggctttgttactgcaat
gtccctcagttctgtgatagtctacctcgatatgaaaccacgcaggtttttggcaggaca
ttgcttcgctccgtctttactgtaatgagacggcaactgctggagcaggccaggcaagag
aaagacaagcttcctcaagagaaacggacactaatcctcacccatttcccaaagtttctg
tcaatgctggaagaagaagtctacagcccaaattctcctatttgggatcaggatttcatg
gtgtctacttctcgaactggccagctgggaatccagacagttatcaatcctcctcctgtt
gcaagatctgtttcatattgtgcaagcccgtcatctctggagcaacccaatagtggaaat
atgagtcctgcttgcaaagtttcttcagtccttgacccaaacttaggggaaaagagaaaa
aataatgaaccgtattctctggaggactcgaaaagaccaagggttgtaggagatattcct
attgagttgatcaatgaagtgatgtcaacaattacagatcctgcggcaatgcttgggcca
gagaccaacttcctctcggcacattcagcccgggatgaggcagcaagactggaggagcgc
aggggggtgattgaattccacgtggttgggaactccctgaaccagaagccaaacaagaag
atcatgatgtggctggttggtttgcagaacgtgttctcccaccagctccctcgaatgcca
aaggagtacatcacacgcttggtttttgatccgaaacacaagactcttgcattaataaaa
gatggtcgcgttattggcggtatctgcttccgaatgttcccttcccaaggatttacagag
atcgttttctgtgctgtgacttccaatgagcaagtcaagggttatggaactcacctaatg
aaccatttgaaggaataccacatcaaacacaacattctcaactttctcacatatgcagat
gaatatgctatcggctacttcaaaaaacaaggtttttccaaagatattaaagtaccaaaa
gcaaaatatgttggctacatcaaggattatgagggtgccacattaatgggatgtgaatta
aatccaaggattccctacacagaattttcggtcatcattaaaaaacaaaaggagatcatt
aaaaagctcatagaaaggaaacaagctcagattcgaaaagtttatcctggcctttcttgc
ttcaaagatggagtacgacagattcctatagaaagcatccctggaattagagagactggc
tggaaaccaagcggaaaagaaagaggtaaagagcccaaggatccagatcaactttacagc
acattaaaaaccattctgcagcaggtgaagagccatcaaagcgcttggcccttcatggaa
cctgtgaagagaacagaagctcctggatattatgaagttataaggtttcccatggatctc
aaaacaatgagtgagcgactcaagaataggtactacgtgtctaagaaattattcatggca
gacttgcagcgagtctttacaaattgcagagagtacaacccccccgagagtgaatactac
aaatgtgccaatatactggagaaattcttctatacaaaaattaaagaagccggattgatt
gataagtga

DBGET integrated database retrieval system