KEGG   Meleagris gallopavo (turkey): 100543976Help
Entry
100543976         CDS       T01523                                 

Definition
stearoyl-CoA desaturase 5-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mgp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mgp01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mgp03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 267 aa AA seqDB search
MTAGQLKWERLEWPTYFCFLMTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQND
IYEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHKDVIEKGRKLDFTDLLDDP
VVRFQRKYYKSSVVLMCFVIPTVVPWYLWGESLWNAYFLASILRYTISLNVTWLVNSAAH
MYGNRPYDKYINPRQNTFVTLGAIGEGFHNYHHTFPFDYSASELGLKFNPTTWFIDFMFW
LGLVTDRKQAPKEMIQARKERTGDGSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacagctggacagctgaaatgggagcggctggagtggcctacatatttctgtttcctg
atgacagccttgggcgtgacagctggtgcgcatcgcttgtggagccaccgttcatacaaa
gccaagctgcctctgcggatcttcctggctgcagctaactccatggccttccagaatgac
atctacgagtggagccgagaccaccgtgtgcaccacaagtactcggagacagatgcagac
ccacacaatgcccgccgtggcttcttcttctcccacattggctggctgtttgtgcgcaag
cacaaagatgtcatagaaaagggaagaaagctggatttcactgatctgctggatgacccc
gttgtcagattccaaagaaagtactacaagagttcggtggtgctgatgtgctttgtgatc
cccaccgttgtgccatggtacctctggggcgagagtctgtggaacgcctacttcctcgcc
tccatcctccggtacaccatatccctcaacgtcacctggctggtcaacagcgctgctcac
atgtatggcaaccgcccttatgacaagtacatcaatcccaggcagaacacctttgtcact
ctgggagccattggtgagggtttccacaattaccaccacaccttccccttcgactactca
gccagcgagctgggcctgaagtttaaccccaccacctggttcattgacttcatgttttgg
ttggggttggtcactgaccggaaacaagctccaaaggagatgatccaggcacgcaaggaa
aggactggagatggcagtgcttga

DBGET integrated database retrieval system