KEGG   Meleagris gallopavo (turkey): 100543976Help
Entry
100543976         CDS       T01523                                 

Definition
stearoyl-CoA desaturase 5-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100543976
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100543976
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100543976
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100543976
Lipid biosynthesis proteins [BR:mgp01004]
 Desaturase
  First
   100543976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 267 aa AA seqDB search
MTAGQLKWERLEWPTYFCFLMTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQND
IYEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHKDVIEKGRKLDFTDLLDDP
VVRFQRKYYKSSVVLMCFVIPTVVPWYLWGESLWNAYFLASILRYTISLNVTWLVNSAAH
MYGNRPYDKYINPRQNTFVTLGAIGEGFHNYHHTFPFDYSASELGLKFNPTTWFIDFMFW
LGLVTDRKQAPKEMIQARKERTGDGSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacagctggacagctgaaatgggagcggctggagtggcctacatatttctgtttcctg
atgacagccttgggcgtgacagctggtgcgcatcgcttgtggagccaccgttcatacaaa
gccaagctgcctctgcggatcttcctggctgcagctaactccatggccttccagaatgac
atctacgagtggagccgagaccaccgtgtgcaccacaagtactcggagacagatgcagac
ccacacaatgcccgccgtggcttcttcttctcccacattggctggctgtttgtgcgcaag
cacaaagatgtcatagaaaagggaagaaagctggatttcactgatctgctggatgacccc
gttgtcagattccaaagaaagtactacaagagttcggtggtgctgatgtgctttgtgatc
cccaccgttgtgccatggtacctctggggcgagagtctgtggaacgcctacttcctcgcc
tccatcctccggtacaccatatccctcaacgtcacctggctggtcaacagcgctgctcac
atgtatggcaaccgcccttatgacaagtacatcaatcccaggcagaacacctttgtcact
ctgggagccattggtgagggtttccacaattaccaccacaccttccccttcgactactca
gccagcgagctgggcctgaagtttaaccccaccacctggttcattgacttcatgttttgg
ttggggttggtcactgaccggaaacaagctccaaaggagatgatccaggcacgcaaggaa
aggactggagatggcagtgcttga

DBGET integrated database retrieval system