KEGG   Meleagris gallopavo (turkey): 100543991Help
Entry
100543991         CDS       T01523                                 

Definition
laminin subunit beta-2-like
Orthology
K06243  
laminin, beta 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100543991
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100543991
Cell adhesion molecules and their ligands [BR:mgp04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100543991
   VLA-6
      100543991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 1814 aa AA seqDB search
MQARHRYLMGTQCLPTTYVLCTQAERKLQALQGKESRLQRRLRELAQRVTALQQRGQDAR
RLAQDAKDGAQRATTASRTLSQDLAQVTQRYVVLKDRVSGMAGVAGGALQRMTRLTAEAR
DLLDKANSSKKRLEXXXXXXXXXAWWQAENGVEHVSIQLDLEAEFHFTHLIMTFKTFRPA
AMLVERSADFGRSWKVYRYFAYDCAASFPHVPRGPPRRIDDVICESRYSDIEPSTEGEVI
YRVLDPAIPIRDPYSPAIQELLRVTNLRVNLTKLHTLGDNLLDSRREIREKYYYALYEMV
LRGNCFCYGHASECAPLSGATATVNGMVHGRCVCKHHTQGLNCERCEDFYHELPWRPAEG
SSTNACRRCDCNEHSRRCHFDMAVFLATGNTSGAVCDGCQHNTMGRRCHLCKPFYYKDPS
KDLRDPAVCRACNCDPEGTVDGGLCDGADDPERGLIAGQCRCKEHVQGPRCDRCKAGFFG
LSAANPQGCQRCRCDPRGTVADGSQCDPISGDCLCKRLVTGRSCDQCLPEHWALSHDLPG
CRPCECDVGGARNNRCAAETGQCQCRRHIVGRQCEQVEPGFYRINLDHYTYEAEDARLHK
GSVVEREPHTDHPASWTGSGFARMQEGGWVEFHVSDVPFSMEYDVIIRYEPQHSEPWKEV
RVQVLRPSPVSASSPCGNTIPADDQLSTSLQSGARYVVLSHPICLERGVPYTIRLELGCA
TGQQDPTASVLIDSLVLLPRYSSMEMFIAGDPAAMGRRETFERYRCAQHFHTVVPSPVAE
PCSRLLHSLSAILHDGALPCLCDPQGSLSAECQPQGGQCRCKPNVVGRRCHRCSLGTFGF
GPGGCRPCQCSGEGSLSAVCDTVTGQCPCRQGAHGSRCDRCQPGHWGFPTCQPCQCNGHA
EECDPQTGSCLRCRDHTDGERCQRXAGXXXXXPALGSGQHCRPCPCPDGPGGPRHFAASC
YQDGRSRQVVCHCSPGYTGPRCDECAPGYYGDPLQPGGRCLPCQCHNNIDMTDPEACDRR
TGQCLRCLYNTAGPHCAECQPGYYGDALRHSCRRCSCNALGTDPSTCGPQQCHCDQRSGQ
CHCLPHVEGQSCDRCSPNFWNLGSGQGCEPCACHPQHSLSPACNQFTGQCSCRPGFGGRT
CADCQEQHWGDPRLQCRACDCDPRGIASAQCHRGSGHCDCRPGVSGVRCDQCARGFSGTF
PACQPCHPCFGDWDRVVQDLASRTRALAQRVSLLHHTGAAGAFEGTFRQLEENLATVRDA
VAARNATATTATFLTHATEGLRQQIGEATEKLTRLESELTVAQDANFNASHVLGMVDRGA
RALNHSLQELGQRLHALKTSNFLGAFDSIRQSHWESQDAERRADASTRVIPSPVSASSAT
RHHTEQLLASRRDAFNRQNAASRRALTELAARAQELSLHPINKKVCGTAGDVPCAESPCG
GAGCRDEDGARRCGGLSCGGAVSKADSALDRARHAQEELRRAAGEVAQLSHRVAEAKGKA
DEAWLQAQAALDKANQTRARVEHSNKELRELISHVKAFLSQEGADPESIEVVASRVLELS
LPASPAQIHRLAEEIKARVRSLASVDAILEQTAGDVRQAGQLLQDAQRAKARAEGVRGTA
EAVQQALEEARQAQGTAGQALHSTAADIQHSERAIGTMQMQTLGAEQQLAAAMERIGLLE
GQTDALKVKRANNSLAATRAHDAAGIARDRASEAKQVLEGPLRDRYRAAQELVQHRAQGA
QQAGGRAQQLREEAAGLLQDAQGKLQKLRALEEEYERNERVLDAKVAQLDGLEARMREVL
ATINQQVQIYNTCQ
NT seq 5445 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcacgccaccggtacctgatgggcacgcagtgcctacccaccacctatgtccta
tgcacccaggcggagcgcaagttgcaggcgctgcagggcaaggagtcacggctgcagcgg
cgactgcgggagctggcacagcgcgtcaccgccctgcagcagcgcggacaagacgcccgg
cgcctggcacaggatgccaaggatggggcgcagcgtgccaccaccgcctcgaggacactc
agccaggacttggcgcaggtgactcagcgctacgtggtgctcaaggaccgggtgagtggg
atggcaggggtggccggaggggccctacagcgcatgacgcggctgacggccgaggccagg
gacctgctggataaggccaacagcagcaagaagcggctggaagnnnnnnnnnnnnnnnnn
nnnnnnnnggcctggtggcaggcggagaacggcgtggagcacgtcagcatccagctggat
ttggaggctgagttccacttcacccacctcatcatgaccttcaagaccttccgccctgca
gccatgctggtggagcgctcggccgactttggccgcagctggaaggtgtaccgctacttc
gcctatgactgtgctgcgtccttcccccacgtcccccgtgggcccccacgccgcattgac
gatgtgatctgcgagtcacgctactccgacatcgagccctccaccgagggggaggtgatc
taccgcgtgctggaccctgccatccccatccgcgacccctacagtcctgctatccaggag
ctgctgcgcgtcaccaacctgcgggtgaacctcaccaagctgcacacactgggggacaac
ctgctggactcacggcgggagatccgcgagaagtactactatgcactgtatgagatggtg
ctgcgtggaaactgcttctgctacgggcacgcctcggagtgcgcgccgctcagcggggcc
acagccactgtgaatggcatggtgcacgggcgctgtgtctgcaagcaccacacgcagggg
ctgaactgtgagcgctgcgaggacttctaccatgagctgccctggcgcccggctgagggc
tccagcaccaacgcctgccgccggtgcgactgcaacgagcactcacggcgctgccacttc
gacatggccgtgttcctggccaccgggaacaccagtggggccgtgtgtgatggctgccag
cacaacaccatgggccgccgctgccatctctgcaagcccttctactacaaggaccccagc
aaggacctgcgggaccctgccgtgtgccgagcctgcaactgcgaccctgagggcaccgtg
gacggagggctgtgtgacggtgccgatgacccagagcgggggctgatcgcagggcagtgt
cgctgcaaggagcatgtgcagggccctcgctgtgaccgctgcaaagctggcttcttcggg
ctcagtgctgccaacccgcagggctgccagcggtgtcggtgtgacccccgtggcacggtg
gccgatggcagccagtgtgaccccatcagcggtgactgcctctgcaagcggctggtgacc
gggcgcagctgtgaccagtgccttcctgagcactgggctctcagccacgatctccctggc
tgccggccttgtgagtgtgatgtgggaggtgcccgcaacaaccggtgtgctgcggagacg
gggcagtgccagtgccgccgccacatagtgggacggcaatgtgagcaggtggagcccggc
ttctaccgcatcaacctggaccactacacctacgaggccgaggatgcccggctgcacaag
ggctcggtggtggagcgtgagcctcacacagatcacccggcttcctggacagggtcaggc
tttgcccgcatgcaggagggcggctgggtagagttccatgtgagcgatgtgcccttctcc
atggaatatgatgtcatcatccgctatgagccacagcactcagagccctggaaggaggtg
agggtgcaggtgctgcgccccagccctgtgtctgccagcagcccatgtgggaacaccatc
ccggccgatgaccagctctccaccagcctccagtctggcgcccggtatgtggtgctctcc
catcccatctgcctggagcggggtgtcccctacaccatccgcctggagctgggctgtgcc
acagggcagcaggaccccaccgccagcgtgctcatcgattcgctggtgctccttccacgt
tactcctccatggaaatgttcattgcgggtgaccctgctgccatgggacgtcgggagacc
ttcgagcggtaccgctgtgctcagcatttccacactgtggtgccgtcaccggtggcagag
ccctgctcccggctcctgcacagcctctcagccatcctgcacgacggggcactgccctgc
ctctgcgacccacagggctcgctcagcgccgagtgccaaccccagggtgggcagtgccgc
tgcaagcccaacgtcgtgggacggcgctgccaccgctgctccctgggcaccttcggcttc
ggacccggcgggtgccgaccctgccagtgcagtggcgagggatcgctgagtgccgtctgc
gacaccgtcacagggcagtgtccctgccgccagggtgcccacggctcacgctgcgaccgc
tgccagccgggtcactggggcttcccaacctgccagccctgccagtgcaatgggcacgcc
gaggagtgcgacccacagacgggcagctgcctgcgctgccgcgaccacacggacggcgag
aggtgccagcggtaagcaggnnnnnnnnnnnnnnnnccggcgctgggctccggccagcac
tgccggccctgcccctgccccgacggacctggcggcccccggcactttgctgcctcctgc
taccaggatgggcgctccaggcaggttgtctgccactgcagccccggatacacaggtccc
cgctgtgatgaatgtgcacccgggtactatggggaccctctgcaacccggcgggcgctgc
ctgccctgccagtgccacaataacatcgacatgacagatccagaggcgtgtgaccggcgc
acggggcagtgcctgcgctgcctctacaacacggcagggccacactgtgccgagtgccag
cctgggtactatggagatgctctgcgacacagttgcaggcgttgctcctgcaatgcactg
ggcaccgaccccagcacctgtgggccgcagcaatgccactgtgaccagcgcagtgggcag
tgccactgcctgccccacgtggagggacagagctgtgaccgctgcagccccaacttctgg
aacctgggcagtgggcagggctgcgagccctgcgcctgccacccccagcactccttgtca
cctgcatgcaaccagttcacagggcagtgctcgtgtcggccgggctttgggggccggacc
tgtgccgactgccaggagcagcactggggtgatccacgtctgcagtgccgagcctgcgac
tgtgacccccgtggcatcgccagcgctcagtgccatcgtggcagtggacactgtgactgc
cggcctggcgtctctggcgtccgctgcgaccaatgcgcccggggcttttctggcaccttc
ccggcctgccagccttgccacccctgctttggggactgggaccgtgtggtgcaggacctg
gcctcccgcacccgggctctggcacaacgggtcagcctcctgcatcacactggggctgcc
ggtgccttcgagggcaccttccgacagctggaggagaacctggccaccgtgcgtgatgca
gtggccgcccgcaatgccaccgccaccactgccacgttcctgacacatgccacagaggga
ttgcggcagcagattggggaagccactgagaaactgacacggctggagagtgagctgaca
gtggcacaggatgccaatttcaatgccagccatgtgctgggcatggtggaccgcggagcc
cgtgccctcaaccacagcctgcaagagctggggcagcggctgcatgccctcaagacctca
aatttccttggtgccttcgacagcatccgccagtcccactgggaatcgcaggatgctgag
cgccgagcggatgcctccacccgtgtcatacccagccccgtcagcgcttcatcagccaca
cggcaccacaccgagcagctcctggccagcaggagggatgctttcaaccggcagaatgca
gccagccggcgggcgctgacggagctggcggccagggcgcaggagctgagcctgcacccg
atcaacaagaaggtgtgtggcactgctggggatgtgccctgcgctgagagcccctgtgga
ggagccggctgccgggatgaggatggggcacgacgctgtgggggactgagctgtggcggc
gccgtctccaaggcggacagtgcgctggaccgtgcacggcacgcacaggaggagctgcgg
cgggcggctggtgaagtggcccagctctcccatagagtggctgaggccaaggggaaggcg
gacgaggcttggctgcaggcgcaggcagccctggacaaggctaaccagaccagggcccgc
gtggaacactccaacaaggagctgcgggagctcatcagccacgtgaaggccttcctaagc
caggagggggctgatcccgagagcattgaggtggtggccagccgtgtgctggagctgtct
ctgcctgcctcaccggcccagatccaccgcctggccgaggagatcaaggcacgggtacgc
agcctggccagtgtggacgccatcctggagcagacagctggcgacgtgcgccaggctggg
cagctgctgcaggatgcccagcgggccaaggcacgggcagagggtgtgcggggcacagct
gaagcagtgcagcaggcactggaggaggcgcggcaagcacagggcacggccgggcaggca
ctgcacagcactgctgctgacatccagcacagtgagcgcgccattggcacgatgcagatg
cagactctgggtgcggagcagcagctggctgctgccatggagcggatcggtctcctggag
ggacagacagatgccttgaaagtgaagcgtgccaacaacagcctggcggccacacgtgcc
cacgatgcagctggcatcgcgcgggaccgtgctagcgaagccaagcaggtgctggagggg
ccgctgagggaccggtaccgggcagcccaggagctggtgcagcaccgggcccagggagca
cagcaggcaggtggccgggcccagcagctgcgcgaggaggccgccgggctgctgcaggac
gcccagggcaagctgcagaagctgcgagcactggaggaggagtatgagcggaacgagcgg
gtgctggacgccaaggtggcccagctggatgggctggaggccaggatgagggaggtgctg
gccaccatcaaccagcaggtccagatctacaacacctgccagtga

DBGET integrated database retrieval system