KEGG   Meleagris gallopavo (turkey): 100544087Help
Entry
100544087         CDS       T01523                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100544087 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100544087 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100544087 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100544087 (HIBCH)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100544087 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 375 aa AA seqDB search
RLKPFNRLQVILQHLKTCQHTDSAADVLLQKRGGAGIITLNRPKVLNALSLRMIQQIYPQ
IKAWEQDPETFLIIIKGTGEKAFCAGGDVRAIADAGKAGDRMTQDYFREEYTLNNAVGTC
KKPYVALIDGITMGGGVGLSVHGHFRVATEKTVFAMPETAIGLFPDVGGGYFLPRLSGKI
GYLLALTGFRLKGRDVLKAGIATHFVESEKLPDLEKDLIALKSPSKENIADLLSSYHNQT
KIDQEKEFVLDEHMEKINSIFSANSMEEIVQKLKQDGSPFAMKQLETMNKMSPTSLKLAL
RQLREGASMSLQDVFTMEYRLSQACMRGHDFYEGVRAVLIDKDQSPRWKPAALEEVSDEF
VDNCFKPLGNNDLKL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
agactgaagccatttaacagactgcaagtaatattacagcacttgaaaacatgtcagcat
accgattctgcagctgatgttctgttgcaaaagagaggaggcgcaggaataataactttg
aacagacccaaggttctcaatgcactaagtttgagaatgatccaacaaatttatccacaa
ataaaggcttgggagcaagatcctgagacttttctaataattataaagggaactggagaa
aaagctttttgtgctggcggtgatgttagagctattgcagatgcaggaaaagctggagac
agaatgacacaagattacttcagagaagagtatacactgaacaatgccgttggcacttgc
aagaagccatatgttgcacttattgatggcattacaatgggagggggagttggcctctcg
gtccatggacatttccgagttgcgactgaaaagacagtttttgcaatgccagaaacagca
ataggccttttccctgatgtaggtggaggttatttcttgccaaggctttcaggaaagatc
ggctatctcctcgcactgacaggattcaggctgaaaggaagagatgtgctaaaagccggc
atcgccacgcatttcgtggaatcagaaaagctacctgacttagagaaagacctgatagca
ttgaaatctccttcaaaagaaaatattgcagacttgctgagctcttaccacaatcagacc
aaaattgaccaagaaaaggagtttgtccttgatgaacatatggagaagattaacagtatt
ttttcagcaaatagcatggaagaaattgttcaaaagttaaagcaagatggttctcctttt
gccatgaagcagttagagactatgaataagatgtcgcctacatccctaaagctggctctc
agacaactcagagaaggtgcttccatgagtttacaagacgtgttcacaatggagtacaga
ctgagccaggcgtgcatgagaggccatgacttctatgaaggggttcgagcagtgctgatt
gacaaggaccagtccccccgctggaagcctgctgctctggaagaagtcagcgatgaattc
gtggacaattgtttcaagcctctgggaaacaacgacctcaagttgtag

DBGET integrated database retrieval system