KEGG   Meleagris gallopavo (turkey): 100544089Help
Entry
100544089         CDS       T01523                                 

Definition
glucose-6-phosphatase 2-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mgp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mgp00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mgp04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mgp04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 355 aa AA seqDB search
MDLLHSNGVLIIQHLQRDYRAYQDFLNFMSHVGDPRNIFSFYFPLWFQLNQVVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVHETMIYPNQSSPCLEQFPITCETGPGSPSGHAMGSS
CVWYVMVTAALSYTVRWKEKSAVSLHRLTRSLLWTIFWIIQISVCISRVFIATHFPHQVI
LGVFAGIVVAEAFEHTPAIQTASLRMYIKTNLFLFIFALGFYLVLKLLDIDLLWSVPKAK
KWCANPDWINIDTTPFAGLVRNLGAFFGLGIGINSEMFITSCKGKNSCKISFRVLCIAAS
LATLQLYNFVKIPTHTEYLFYILSFCKSAAMPLTVVALVPYCVHTLMRTTDKKCN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatctccttcatagcaatggagtgcttatcattcagcatttacagagagactacagg
gcttaccaggatttccttaattttatgtcacatgttggagatcctcggaatatattctca
ttttattttcctctttggtttcagctcaaccaagtggttggtactaaaatgatatgggtg
gcagtcattggtgattggttcaacctgatatttaaatggattttattcggccatcgtccc
tactggtgggtgcatgagacaatgatttatcccaatcagtcaagcccatgccttgaacag
tttcccataacatgtgaaactggaccagggagcccatctggacacgcaatgggatcttcc
tgcgtctggtatgtaatggtaacggcagcacttagctacacagtgaggtggaaagagaaa
tcagcagttagccttcacagactgacacggtcgttactctggactattttttggattatc
cagatcagcgtatgcatctcaagagtattcatagcaacacatttccctcatcaagttatt
cttggagtatttgctggaattgttgtggcagaagcatttgagcatacccctgctattcag
acagcaagtttgagaatgtacatcaagacaaacttgtttcttttcatctttgcccttggt
ttttacctagtcctcaagcttcttgatattgacttgctgtggtctgtcccaaaggccaag
aagtggtgtgccaatccagactggataaacattgacacaactccgtttgctggactggtg
agaaatttaggtgcattctttggcttaggtattggtattaattcagaaatgttcatcacc
agctgcaagggtaaaaacagctgtaagataagtttccgcgtattgtgtatagctgcttct
ttagctacactacagctgtataattttgttaagatacctactcatactgagtatttgttc
tacattctctctttttgtaagagtgcagctatgcctctgactgtagtcgccttggttcca
tactgtgtccacacgttaatgagaacaactgataagaaatgtaattag

DBGET integrated database retrieval system