KEGG   Meleagris gallopavo (turkey): 100544089Help
Entry
100544089         CDS       T01523                                 

Definition
glucose-6-phosphatase 2-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100544089
   00052 Galactose metabolism
    100544089
   00500 Starch and sucrose metabolism
    100544089
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100544089
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100544089
   04920 Adipocytokine signaling pathway
    100544089
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100544089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 355 aa AA seqDB search
MDLLHSNGVLIIQHLQRDYRAYQDFLNFMSHVGDPRNIFSFYFPLWFQLNQVVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVHETMIYPNQSSPCLEQFPITCETGPGSPSGHAMGSS
CVWYVMVTAALSYTVRWKEKSAVSLHRLTRSLLWTIFWIIQISVCISRVFIATHFPHQVI
LGVFAGIVVAEAFEHTPAIQTASLRMYIKTNLFLFIFALGFYLVLKLLDIDLLWSVPKAK
KWCANPDWINIDTTPFAGLVRNLGAFFGLGIGINSEMFITSCKGKNSCKISFRVLCIAAS
LATLQLYNFVKIPTHTEYLFYILSFCKSAAMPLTVVALVPYCVHTLMRTTDKKCN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatctccttcatagcaatggagtgcttatcattcagcatttacagagagactacagg
gcttaccaggatttccttaattttatgtcacatgttggagatcctcggaatatattctca
ttttattttcctctttggtttcagctcaaccaagtggttggtactaaaatgatatgggtg
gcagtcattggtgattggttcaacctgatatttaaatggattttattcggccatcgtccc
tactggtgggtgcatgagacaatgatttatcccaatcagtcaagcccatgccttgaacag
tttcccataacatgtgaaactggaccagggagcccatctggacacgcaatgggatcttcc
tgcgtctggtatgtaatggtaacggcagcacttagctacacagtgaggtggaaagagaaa
tcagcagttagccttcacagactgacacggtcgttactctggactattttttggattatc
cagatcagcgtatgcatctcaagagtattcatagcaacacatttccctcatcaagttatt
cttggagtatttgctggaattgttgtggcagaagcatttgagcatacccctgctattcag
acagcaagtttgagaatgtacatcaagacaaacttgtttcttttcatctttgcccttggt
ttttacctagtcctcaagcttcttgatattgacttgctgtggtctgtcccaaaggccaag
aagtggtgtgccaatccagactggataaacattgacacaactccgtttgctggactggtg
agaaatttaggtgcattctttggcttaggtattggtattaattcagaaatgttcatcacc
agctgcaagggtaaaaacagctgtaagataagtttccgcgtattgtgtatagctgcttct
ttagctacactacagctgtataattttgttaagatacctactcatactgagtatttgttc
tacattctctctttttgtaagagtgcagctatgcctctgactgtagtcgccttggttcca
tactgtgtccacacgttaatgagaacaactgataagaaatgtaattag

DBGET integrated database retrieval system