KEGG   Meleagris gallopavo (turkey): 100544281Help
Entry
100544281         CDS       T01523                                 

Definition
DNA repair and recombination protein RAD54B-like
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100544281
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100544281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 918 aa AA seqDB search
MRRSAAPSQVQGNVAKKPRFIPPGKSNAVCPRIETEKMDQGMKLKEVGEKHGNVSLFSEV
FGENQNENFTQSVESSGKVKSTKAWNSTSKCSKLEMKTQSAPKADAVYLPTSGMAKEAAA
QEEPDCLTKYFSVMWCKASKKKHKKWEGDAILITKGKSVMLKDMEGKDIGRGTGYKSKEL
DSLEEGQTLMIGGKEIEVMGVISADDFSSGRCFQTGIATHDTVPTALPQTTVKQFCKPIK
SACRPSTKENILLNSQSRKPRHNPNDANSLVMPRPNASHQCMFNKAGLPVVDVVVDPYIA
NNLRPHQREGIVFLYECVMGMRVSGRFGAILADEMGLGKTLQCISLVWTLLRQGVYGCKP
VLKRALIVTPGSLVKNWKKEFQKWLGSERIKVFTVDQDHKVEEFISSPLYSVMIISYEML
LRSLDQIQDIEFNLLICDEGHRLKNSSIKTTTALTSLSCERRIILTGTPIQNDLQEFYAL
IEFVNPGVLGSLSTYRKIYEEPIVRSREPSATKEEKDLGEKRAAELTRLTGLFVLRRTQE
VIDKFLPPKKENIIFCQPTALQLELYRKLLSSRVITSCLQGRLENSPHLICIGALKKLCN
HPCLLFKAVKEKSCDPKSDEHVESSLYEGLTDVFPQDYTSDIFSETDSGKLQVLVKLLAA
IRELSSSERVVLVSNYTQTLNILQETCKRYGYSYTRLDGNTPVSQRQQIVDSFNCKFSPA
FIFLLSSKAGGVGLNLVGASHLILYDIDWNPATDIQAMARVWRDGQKHTVHIYRLLTTGS
IEEKIYQRQISKQDLSGAVVDLSKTSEHIHFSVEELKNLFTLHENSSCVTHDLLECDCVG
NKDHQNSSSKKPSVSRCCQLRQDQGKHNIKKPLSMSQLMQWKHFSGQHQDLPDPFLERIK
ENVSFIFQNVTNPTSPTQ
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgatcagcagctccaagtcaagtgcaaggaaatgtagccaaaaaaccaaggttt
ataccaccaggaaaaagtaatgcagtttgtcccaggattgaaactgagaaaatggaccaa
ggcatgaaattaaaggaggtaggtgagaaacatggaaatgtttcactgttttctgaagtg
tttggcgagaatcagaatgaaaattttacacagtctgttgagtcatctggaaaagtaaag
tctacaaaagcatggaacagcactagtaagtgcagcaagttggaaatgaaaacacagagt
gcacccaaagctgatgcagtgtatttgccaacatcagggatggcaaaggaagcagcagcg
caggaagaacctgactgcctcacaaagtatttcagtgttatgtggtgtaaggcatcaaag
aagaagcacaagaagtgggaaggcgatgctattcttattacaaaaggaaagtcagtcatg
ttgaaagacatggaaggcaaagacattggcagaggtactggatataaatctaaagagtta
gacagtcttgaggaaggtcaaacactgatgattggaggaaaagaaattgaagtgatgggt
gtaatttcagcagatgacttcagcagtggcaggtgttttcagactggaatagcgactcat
gacacagtcccaactgctttacctcaaactaccgtgaaacaattctgtaagccaatcaaa
agtgcctgccgacccagtactaaagagaatattctcctcaattctcagagccgcaaacct
cgtcacaatccaaatgatgcaaattctctagttatgccaagaccaaatgcaagtcatcag
tgcatgttcaacaaggctggtttacccgtggtggatgtagtggtggatccttacattgca
aataatctccgaccacatcagagagaaggaattgtatttctatatgaatgtgtaatggga
atgagagttagtggcagatttggagctatccttgctgatgaaatgggcttaggaaaaaca
ttgcagtgcatttcacttgtctggactcttctccgtcaaggggtctatggatgtaaacct
gtactgaagcgagcactaattgtcacccctgggagtctggtaaaaaactggaaaaaagaa
tttcagaaatggttgggaagcgaaaggatcaaagtctttacagttgatcaggaccataaa
gtagaagaattcatcagttctccactttattcagttatgataatcagctatgagatgctg
ctacgatctctggatcaaattcaggatatagaatttaacctcctgatctgtgatgaagga
catcgtctgaaaaatagctctattaagactactacagccctcactagtctgtcttgtgag
aggagaattatccttactggtactccaatccaaaatgacttgcaagaattttacgcttta
atagaatttgtaaatccaggggtacttggttctttatccacatacagaaaaatatatgag
gagcccattgtcagatccagagaaccttcagcaacaaaggaggaaaaggatttaggagaa
aaaagagcagcagaactcacacgcctcactggactctttgttcttaggagaacacaggag
gttatagacaaatttcttccaccaaaaaaggagaacattatcttctgccaaccaacagca
ctgcagcttgaattgtatcgaaaactactcagttctcgtgttattacctcctgtctacaa
ggcaggctagaaaatagtcctcacctaatatgtataggagctttgaaaaaactttgcaat
catccatgtcttctgtttaaagctgtaaaggaaaaatcctgtgatccgaaaagcgatgag
catgttgagtccagtctctacgaaggtctaacagatgtctttccacaagattatacttct
gacattttctctgaaacggattcaggaaaattgcaggtgctggtgaagttgttagcagca
atccgagagctcagctcttctgaaagagttgtactggtatccaattacactcagacactg
aacatactacaggagacatgtaaacgttatggatattcttatactagacttgatggaaat
actcctgtctcccagaggcaacagattgttgatagttttaattgtaaattcagtccagct
ttcatctttttgctgagttcaaaagctggtggagtgggactgaatctggttggagcttct
cacttgatcctttatgatatcgactggaatccagctactgatattcaggcaatggccaga
gtgtggagagatggtcagaaacatactgtacatatctacagacttctaaccacaggctca
atagaagaaaagatttatcaaagacagatcagcaaacaggacctttcgggggcagttgta
gacctttccaagacatctgaacatatccatttttctgttgaggagctcaaaaatctcttt
acacttcatgagaattccagctgtgttacccatgacttacttgaatgtgattgtgtggga
aacaaagaccatcaaaattcttcctcaaaaaagccttcagtgtctagatgttgtcagctc
agacaagaccaggggaagcataatataaagaaacctctctccatgtcacagctgatgcaa
tggaagcatttctctgggcaacatcaagatctacctgatccttttcttgaaaggataaaa
gaaaatgtttctttcattttccagaatgtaaccaatcctacttcccccacccaataa

DBGET integrated database retrieval system