KEGG   Meleagris gallopavo (turkey): 100544308Help
Entry
100544308         CDS       T01523                                 

Gene name
ENTPD2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2
  KO
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100544308 (ENTPD2)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     100544308 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 449 aa AA seqDB search
HTAVFIYKWPADKENDTGVVSEHSMCDVEGPGISSYSSKPPAAGKSLEHCLSQAMRDVPK
EKHAGTPLYLGATAGMRLLRIADPKSSDAVLSEVMATLKSYPFDFRGAKILSGEEEGVFG
WVTANYLLENFIKRGWLGEWIQSKKRTLGAMDFGGASTQITFETSDAIEDPRNEVMLKLY
GQPYKVYTHSFLCYGRDQVLKRLLSKVLKAENYQETVANPCWPTGYHKSLSLSSIYDSPC
TEKERPGLPLSTTVVVSGTGNGNLCAVHVSKLFDFTNCSFSRCSFDGVFQPEVSGNFIAF
SAFFYTVDFIQTVMERPVHLPSDLKDAAETICATSWNELYQKAPRLEKRLPDYCATSMFV
YLLITKGYNFNNRSFPSIAFQKKAGETSIGWALGYMLNLTNMIPAEEPASHRSMLYNYWV
ILILLFVITTLTALLTAVYLLRHSKSSTI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
cacacggccgtgttcatctacaagtggcccgcggacaaggagaacgacactggggtggtc
agcgagcacagcatgtgcgatgtggagggtcctggcatctccagctacagctccaaacct
ccggctgctgggaaaagcttagaacactgcctgagccaggctatgagagacgtgcccaag
gagaagcatgcaggcactccgctctacctgggtgccacggctggcatgcgcctgctcaga
attgcagacccaaagtcctcagacgccgtcctcagtgaagtgatggccacactgaagtcg
tacccctttgatttccggggagcaaagatcctgtcaggggaagaggagggggtgtttggc
tgggtcacagcaaactacctcctggagaacttcatcaagcgtggttggcttggggaatgg
atccaatccaagaagaggaccctgggggccatggacttcggaggcgcttccacacagatc
acctttgaaaccagtgatgccattgaagatcccagaaatgaggtgatgctgaagctgtat
ggccagccatacaaggtgtacacccacagcttcctctgctatggaagggaccaggtcctc
aagaggctgctctcaaaggtcctcaaggctgagaactaccaagaaactgtcgccaatcct
tgctggcccacgggctaccacaagagtctgtcactgagcagcatttatgacagcccctgc
acggagaaagagcggcccggccttcccctcagcaccaccgtcgtcgtgtctggcaccggg
aatgggaacctctgtgctgtgcacgtcagcaagctctttgacttcaccaactgctccttc
tcccgctgctccttcgatggcgttttccagcctgaggtttcaggaaacttcattgccttc
tctgccttcttctacacggtggacttcatccagacagtgatggagagacctgtgcacttg
cccagtgacctgaaggacgctgctgagaccatctgtgccaccagctggaatgagctgtac
cagaaagctcccaggctggagaagaggctgcctgactactgtgctaccagcatgtttgtt
tatctgctcatcacaaagggctacaacttcaacaaccgctccttccccagtattgccttc
cagaaaaaggcaggagaaacctccatcggttgggcccttggctacatgctgaacctcacc
aacatgatcccggcagaggagcctgcttcccacagaagcatgctgtacaactactgggtc
atcctcatcctgctctttgtgatcaccaccctgacagctctgctgactgctgtctacctg
ctccggcacagcaagtccagcacaatctaa

DBGET integrated database retrieval system