KEGG   Meleagris gallopavo (turkey): 100544348Help
Entry
100544348         CDS       T01523                                 

Definition
beta-hexosaminidase subunit alpha-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mgp00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:mgp00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:mgp00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:mgp00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mgp00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mgp04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 452 aa AA seqDB search
FAAARPAENKQSWRTSCTELLISVATPGCNGFPNLESKENYKLNISRDSMLLYADAVWGA
LRGLETFSQLVGRDENGMYYINETEIVDFPRFPHRGLLLDTSRHYLPLKAILETLDVMAY
NKLNVFHWHIVDDPSFPYESFTFPELSKQGAFSAMTHVYTASDVQTVIEYARLRGIRVIA
EFDTPGHTLSWGPGAPGLLTPCYLGKDPSGTYGPINPIFNSTYQFVTSLFQEISSVFPDY
FIHLGGDEVDFTCWKSNPDILVFMKKMGFGEDYTKLESYYIQRLLDIVSSLGKGYMVWQE
VFDNGVKVRPDTIIHVWKNNLPYAEEMANVTKAGYRALLSAPWYLNRISYGQDWMAAYQV
EPLKFTGSTKQKDLVIGGEACMWGEYVDVTNLTPRLWPRAGAVAERLWSNATVRNLQDAY
VRLADFRCELLRRGVQAEPLFTGYCDHEFGGF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttcgccgcggcgcggcccgcagagaacaagcagtcctggaggacatcctgcactgaactc
ctcatctcggttgccacaccaggctgcaatggctttcccaacctggagtccaaggagaac
tataaattgaatatctcaagagattccatgctgctctatgccgatgctgtttggggagct
cttagaggcctggagacattcagccagcttgttgggagagacgagaacggcatgtactat
atcaatgagacagaaattgtggactttccccgcttccctcaccgaggcctgttgctggac
acctctcgccactacctgcctctgaaagccatcttggaaactctggatgtcatggcttac
aacaagttaaatgtgtttcactggcacattgtggacgacccgtcattcccatatgagagc
tttactttcccagagcttagcaagcagggagctttcagtgccatgacccatgtgtacaca
gccagtgatgtgcagacagtaatcgagtatgctcgtctccgtggcatcagagtcattgca
gagtttgacacacctgggcacacactttcctggggtccaggtgctccaggcctcctgact
ccttgctatttggggaaggatccttctgggacctatgggcccatcaaccccatcttcaac
agcacctaccagtttgtgaccagtttgtttcaggagatcagctcagtgttcccagactac
tttattcacctcggtggtgatgaggtggacttcacgtgctggaagtccaatccagacatt
cttgtcttcatgaagaagatgggctttggtgaagattacacaaaattggaatcatactac
atccagagactcctggacatcgtctcttctcttggcaagggctatatggtgtggcaggag
gtgtttgacaatggagtgaaggtgaggccagacacaatcatccatgtgtggaagaacaat
ctgccgtatgcggaggagatggcaaatgtcactaaggctggctacagggctctgctctct
gccccctggtacctcaaccgcatctcctacgggcaagactggatggcagcctaccaagtg
gagcccttaaagttcactggcagcactaagcagaaggatctggtgattggcggggaggcg
tgcatgtggggtgaatacgtggacgtcaccaacttgacccccaggctctggccgagagcc
ggggctgtggctgagagactttggagtaatgcaacagtgaggaacctgcaagatgcttat
gtgcggttggctgacttccgctgcgagcttctcaggcggggtgtccaggcagagcctctc
ttcacaggatactgtgatcatgaatttggcgggttttga

DBGET integrated database retrieval system