KEGG   Meleagris gallopavo (turkey): 100544375Help
Entry
100544375         CDS       T01523                                 

Definition
ecto-ADP-ribosyltransferase 4-like
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100544375
Cellular antigens [BR:mgp04090]
 Proteins
  100544375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 289 aa AA seqDB search
MSVLLLASILLLILQRLAVSHLMMDMALHSFDDQYLGCREQMMEELERGDYFRKEIAASK
NYLNLWKKAQEALLKSPVGLLREMHDSHATVLMAYTMNSSLHSQLNWATSTAGRSPEHYK
HNFSYKYFHFYLTTAIQIMKQWQSSKDSVGKRHCYRVHRGVKDLYIEATVGSMVRFGRFT
STSRLWNEAQKFGNETLFTVTTCLGAAMQGFSYYTSEKEVLIPPYEIFLVKNFFRTQHGN
RLHLHSVGNYSRYRCQLLEASRIKNSGSTASASVILFSVVGVLLCWAKQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgcttcttctggccagtattctgttgctgatcttgcaaagattggcagtgtcc
caccttatgatggatatggctctacattcctttgatgatcagtacctgggttgcagagag
cagatgatggaagaactggagcggggagactatttcaggaaggaaatagctgctagtaaa
aactatttgaacctctggaagaaggctcaggaagctttgctgaagagccctgtaggtctc
ctgagggagatgcatgatagtcatgccaccgtcctcatggcttacaccatgaattcttcc
ctgcactctcaactgaactgggccacatccacagcaggaaggtctccagagcattacaaa
cacaacttcagctacaaatattttcacttttacctaacgacagctatccagataatgaag
cagtggcagagcagcaaggacagcgtggggaaacgtcactgctaccgggtgcacagaggt
gtgaaggacttatatattgaagctacagttggcagcatggtgcgatttggccgtttcacc
tccacctctcgcctctggaatgaagcccagaaatttgggaacgaaactttgtttacggtg
acaacctgcctgggagcagctatgcaaggcttttcttactacacatctgagaaggaagtc
ctcattcccccttatgagatattccttgtcaaaaacttctttcggacacagcatggtaac
cggctccacctgcattctgtggggaactacagcaggtaccgctgccagctcttggaagct
tcaagaatcaagaacagtggatctactgcctctgcctccgtcattctttttagtgtagtt
ggagttttattgtgctgggccaagcaatga

DBGET integrated database retrieval system