KEGG   Meleagris gallopavo (turkey): 100544448Help
Entry
100544448         CDS       T01523                                 

Definition
cytochrome P450 2C29-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mgp00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mgp00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mgp00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mgp00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 454 aa AA seqDB search
MLLLGAASVVLLVCVACLLSIVQWRKRSGKGKMPEGPAPLPIVGNILQVKPKNLAKTLEK
LSEKYGPVFSVQLGSTPVVVLSGYEVVKEALIARADEFAARGHMAIGDRANKGLGIIFSN
NEEWLQVRRFALTTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRMPFDPTFKLSCAVSN
VICSIVFGKRYDYKDKKFLSLMNNMNNIFEMMNSLWGQAILRLERDTGLAVMHTRPYITM
FFRILHAEWPKQWCQEFVKNKGTGSNNSTIRSSWLVLLAVLLMTEKVQEEIDRVVGRSRR
PCVADRTQMPYTDAVVHEIQRFITLIPTSVPRAVTKDIRFRDYVIPKGTTVFPLLSTALY
DSKEFPNPTEFNPGHFLNQNGTFRKSEFFIPFSAGKRICPGEGLARMEIFLLLTAILQNF
TLKPVISPEELNITPTLSGTGNVPPYYQLCAVPR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcctgggagcagcgagcgttgtcctcctggtttgtgttgcttgcctgctctcc
attgtgcaatggagaaaaaggtctggaaaggggaagatgcctgagggaccagctcccctt
cccatcgtagggaacatactgcaggtgaaaccaaagaatttagccaaaactcttgagaag
ctctctgaaaaatatgggccggtcttctcagtgcaactgggttcaactccagtagtggtg
ctgtctggatatgaggtggtgaaagaagccttgattgctcgtgcggatgagtttgctgcc
cgaggacacatggctatcggggaccgggctaataaaggattaggcattattttcagcaac
aacgaggaatggttacaagttcggcggtttgctctcaccactctgcgcaactttgggatg
gggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatc
acaaaaacaaagagaatgcccttcgacccaacattcaagctgagctgcgctgtctccaat
gtcatatgctccatcgtctttgggaaacgatacgattataaagacaaaaagttcctgtcc
ctgatgaacaacatgaacaacatatttgaaatgatgaattccctctggggacaggccata
cttcgcctagagagagatactgggctagctgttatgcacacaagaccatacatcaccatg
ttcttcagaatattgcatgcagagtggccaaagcagtggtgtcaggaatttgtcaagaac
aagggcacaggcagcaacaacagcacaatcagaagctcgtggcttgtcttattggctgtg
cttctcatgacagagaaagttcaagaagagattgatcgggtagtaggacgatcacggaga
ccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccatgaaatccag
cgcttcatcaccctcatccctacaagcgtccctcgagctgtcaccaaagacatccgcttc
agagactacgtcattcccaagggcaccacagtctttcccctcctcagtactgcactgtac
gacagcaaggagtttccaaacccaactgagtttaatcctggacatttcttgaaccagaat
ggcacctttaggaagagcgagttcttcattcccttctcagcagggaaacgaatttgcccc
ggagagggcctggcacgcatggagatattcttactcttgaccgccatcctgcagaacttc
accttgaagcctgtcatcagccctgaggaactcaacatcaccccaacactgagtgggaca
ggaaatgttcctccctactaccagctctgtgccgtcccccgctga

DBGET integrated database retrieval system