KEGG   Meleagris gallopavo (turkey): 100544448Help
Entry
100544448         CDS       T01523                                 

Definition
cytochrome P450 2C29-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100544448
   00590 Arachidonic acid metabolism
    100544448
   00591 Linoleic acid metabolism
    100544448
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100544448
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100544448
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP2 family
   100544448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 454 aa AA seqDB search
MLLLGAASVVLLVCVACLLSIVQWRKRSGKGKMPEGPAPLPIVGNILQVKPKNLAKTLEK
LSEKYGPVFSVQLGSTPVVVLSGYEVVKEALIARADEFAARGHMAIGDRANKGLGIIFSN
NEEWLQVRRFALTTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRMPFDPTFKLSCAVSN
VICSIVFGKRYDYKDKKFLSLMNNMNNIFEMMNSLWGQAILRLERDTGLAVMHTRPYITM
FFRILHAEWPKQWCQEFVKNKGTGSNNSTIRSSWLVLLAVLLMTEKVQEEIDRVVGRSRR
PCVADRTQMPYTDAVVHEIQRFITLIPTSVPRAVTKDIRFRDYVIPKGTTVFPLLSTALY
DSKEFPNPTEFNPGHFLNQNGTFRKSEFFIPFSAGKRICPGEGLARMEIFLLLTAILQNF
TLKPVISPEELNITPTLSGTGNVPPYYQLCAVPR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcctgggagcagcgagcgttgtcctcctggtttgtgttgcttgcctgctctcc
attgtgcaatggagaaaaaggtctggaaaggggaagatgcctgagggaccagctcccctt
cccatcgtagggaacatactgcaggtgaaaccaaagaatttagccaaaactcttgagaag
ctctctgaaaaatatgggccggtcttctcagtgcaactgggttcaactccagtagtggtg
ctgtctggatatgaggtggtgaaagaagccttgattgctcgtgcggatgagtttgctgcc
cgaggacacatggctatcggggaccgggctaataaaggattaggcattattttcagcaac
aacgaggaatggttacaagttcggcggtttgctctcaccactctgcgcaactttgggatg
gggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatc
acaaaaacaaagagaatgcccttcgacccaacattcaagctgagctgcgctgtctccaat
gtcatatgctccatcgtctttgggaaacgatacgattataaagacaaaaagttcctgtcc
ctgatgaacaacatgaacaacatatttgaaatgatgaattccctctggggacaggccata
cttcgcctagagagagatactgggctagctgttatgcacacaagaccatacatcaccatg
ttcttcagaatattgcatgcagagtggccaaagcagtggtgtcaggaatttgtcaagaac
aagggcacaggcagcaacaacagcacaatcagaagctcgtggcttgtcttattggctgtg
cttctcatgacagagaaagttcaagaagagattgatcgggtagtaggacgatcacggaga
ccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccatgaaatccag
cgcttcatcaccctcatccctacaagcgtccctcgagctgtcaccaaagacatccgcttc
agagactacgtcattcccaagggcaccacagtctttcccctcctcagtactgcactgtac
gacagcaaggagtttccaaacccaactgagtttaatcctggacatttcttgaaccagaat
ggcacctttaggaagagcgagttcttcattcccttctcagcagggaaacgaatttgcccc
ggagagggcctggcacgcatggagatattcttactcttgaccgccatcctgcagaacttc
accttgaagcctgtcatcagccctgaggaactcaacatcaccccaacactgagtgggaca
ggaaatgttcctccctactaccagctctgtgccgtcccccgctga

DBGET integrated database retrieval system