KEGG   Meleagris gallopavo (turkey): 100544492Help
Entry
100544492         CDS       T01523                                 

Definition
deoxycytidine kinase-like
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100544492
   00240 Pyrimidine metabolism
    100544492
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100544492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 305 aa AA seqDB search
MLTQPPRLQSFNVREKRRCKMGNVRAEPLLSAHRANVLFPGTARYFGVKREQILMYDNET
ECLKIRTVFESSAGKSTFVDILKQADEGWEVVPEPVARWCNVQQNSEEDCEELTTSQKSG
GNVLQMMYEKPERWSFTFQMYACLSRIRAQLKSIDGKLREAENPVVFFERSVYSDRYIFA
ANLYESDCMNETEWTIYQDWHDWMNKQFGQSLALDGIIYLRATPEKCLNRIYLRGRDEEQ
EIPIEYLEKLHYKHESWLQHKTLRTDFEYLQEIPILTLDVNEDFKGKKDRYDHMTEKVKE
FLSTL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctaacacagcctcctcgtttacagtctttcaacgtccgggagaaaagacggtgcaaa
atggggaatgtgagagcagagcccttgctatccgctcaccgtgccaatgttctgttccca
ggcaccgctcggtatttcggtgttaagcgagaacagattttgatgtacgacaacgaaact
gaatgtctgaaaatccgcaccgtgttcgagagttctgctggaaaatcaacatttgtggat
attctcaaacaagctgatgagggatgggaagttgttcctgagcctgtagctagatggtgc
aacgttcaacaaaactctgaagaggattgtgaggaactgactacgtcacagaagagtggt
ggaaatgtgcttcagatgatgtatgagaaaccggagaggtggtctttcactttccagatg
tacgcgtgtctcagcaggattcgggctcagctcaaatccattgatggcaaactcagagag
gcagaaaatcctgtggtgttctttgagcgatctgtctacagtgatagatatatctttgca
gctaatttatatgagtctgactgtatgaatgaaactgagtggactatttaccaagactgg
catgactggatgaataagcagtttggtcaaagcctagcactggatgggattatttatctc
agagccactcctgagaaatgcttaaataggatttacttgcgtgggagggatgaagagcaa
gaaattcctattgaatatctggagaagcttcactacaaacatgaaagctggcttcagcat
aagacactgcgaacagattttgaatatctacaagaaatacctattttaacattagatgtt
aatgaagacttcaaaggcaaaaaggacagatacgatcacatgactgagaaggtgaaggaa
tttttgagcacattataa

DBGET integrated database retrieval system