KEGG   Meleagris gallopavo (turkey): 100544644Help
Entry
100544644         CDS       T01523                                 

Definition
profilin-3-like
Orthology
K05759  
profilin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mgp04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mgp05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 134 aa AA seqDB search
MNCWKYYIDCILSDRNIDDVAIVGLSDNKCVWAAKPGGLLSAVSPYEVDLITSQDRKTFL
MTGITIAGKKCSVIRDSLLVEGDNVMDVRSKGGNSRSICVGRTPKALIFLMGNRGVHGGV
LNQKIHDMIASMTL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaactgctggaagtattacattgactgcatcctgagcgacaggaacattgatgatgtg
gccattgtggggctctccgacaacaagtgcgtatgggcagccaagccaggagggctgctg
tcggctgtgtcaccttatgaagtggacttgatcacaagccaggataggaaaacattcctg
atgactggaatcaccatcgcagggaaaaagtgcagtgtgattcgtgatagcctgctggta
gaaggagacaatgtgatggatgtcagaagcaaaggtggtaacagcagatccatctgtgta
ggcaggacccccaaagctctgatcttcctcatgggcaacagaggagtccatggaggagtc
ctcaatcagaagatccatgacatgattgccagcatgacactgtga

DBGET integrated database retrieval system