KEGG   Meleagris gallopavo (turkey): 100544690Help
Entry
100544690         CDS       T01523                                 

Definition
histone H2B.3-like
Orthology
K11252  
histone H2B
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 111 aa AA seqDB search
MRGHASSSGDKKSKRKPKRKETYSVYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERLA
VEASRLAQYNHRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggtcatgcttcctcctctggtgacaagaagtccaagagaaagcctaagagaaag
gaaacttattcagtctatatctacaaagttctgaagcaggtgcaccctgacacaggaatc
tcctccaaggccatgagcatcatgaactcgtttgtcaatgacatctttgagcggctggcc
gtggaggcgtcgcgcctggctcagtacaaccaccgctccaccatcaccagcagggaggtg
cagacggccgtgcggctgctgctgcctggtgagctggccaagcacgccgtgtccgaaggc
accaaggctgtcaccaagtacaccagcagcaagtga

DBGET integrated database retrieval system