KEGG   Meleagris gallopavo (turkey): 100544690Help
Entry
100544690         CDS       T01523                                 

Definition
(RefSeq) late histone H2B.L4-like
  KO
K11252  
histone H2B
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100544690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 118 aa AA seqDB search
MSAESGKMRGHASSSGDKKSKRKPKRKETYSVYIYKVLKQVHPDTGISSKAMSIMNSFVN
DIFERLAVEASRLAQYNHRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagaaagtgggaagatgcgtggtcatgcttcctcctctggtgacaagaagtcc
aagagaaagcctaagagaaaggaaacttattcagtctatatctacaaagttctgaagcag
gtgcaccctgacacaggaatctcctccaaggccatgagcatcatgaactcgtttgtcaat
gacatctttgagcggctggccgtggaggcgtcgcgcctggctcagtacaaccaccgctcc
accatcaccagcagggaggtgcagacggccgtgcggctgctgctgcctggtgagctggcc
aagcacgccgtgtccgaaggcaccaaggctgtcaccaagtacaccagcagcaagtga

DBGET integrated database retrieval system