KEGG   Meleagris gallopavo (turkey): 100544768Help
Entry
100544768         CDS       T01523                                 

Gene name
PLA2G15
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100544768 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100544768 (PLA2G15)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100544768 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 388 aa AA seqDB search
MLLKLPHKFSLDLEIRISVPGDLGNQLEAKLDKPSVVHYLCSKKTDSYFTLWLNLELLLP
VIIDCWIDNIRLVYNRTSKVTEPPDGVDIRVPGFGQTFSLEFLDPSKRSVGSYFYMLVQS
LVDWGYKRDEDVRGAPYDWRKAPNENGDYFVALRKMIELMYEQYGSPVVLIAHSMGNMYT
LYFLNHQTQEWKDKYIKDYVSLGAPWGGVAKTLRVLASGDNNRIPVISSLKIRDQQRSAV
STNWMLPYNYTWPPDKVFVSTPTANYTLRDYRKFYRDIDFEDGWLMRQDTEPLVYQMIPP
GVRIHCLYGTGVETPDSFHYESFPDKEPKIIYSDGDGTVNLQSALQCQKWVDMQKQEVVV
FELSGNEHIQMLSNDTTISYVKKLLFNL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgctcctaaaacttcctcataagtttagtctggatttggaaataagaatttcagttcca
ggggacttaggtaatcagttggaagcaaaattagataaaccatcagtagtgcactatctc
tgctctaagaagactgacagttactttacactgtggctgaacttagaattgctcctacct
gtcatcattgactgctggattgacaatatcaggctggtatataacagaacaagcaaagta
acagaaccaccagatggagtggatatcagagtcccaggttttgggcagacattttccttg
gaattccttgatccgagtaaaaggagcgttggcagttacttctacatgctggtgcagagt
ttagtagactggggctacaaacgtgatgaagatgtaagaggagcaccttatgactggcga
aaggcaccaaatgagaatggagattattttgtggcccttcgcaagatgatagagttaatg
tatgagcagtatggaagtcctgttgtcttaattgcccacagcatgggtaatatgtatacc
ctgtacttcctcaatcatcagactcaggaatggaaagacaaatacataaaagactacgtg
tcattaggtgctccatggggaggagtggccaaaactctccgtgtgctggcttcaggtgac
aacaacagaataccagtcatcagttcactcaaaattcgagaccagcagagatcagctgtt
tccacaaattggatgctcccctacaactacacatggcctccagataaggtctttgtaagc
acacctacagcaaactacaccttacgagactacagaaaattctacagggacattgacttt
gaagatggctggctcatgagacaagacactgaacccttggtctaccagatgataccacct
ggtgtacgcatacactgtctttatggtactggtgtggaaacacctgattccttccattat
gagagctttcctgacaaagagcccaagattatttacagtgatggggatggtacagtgaac
ttacagagtgccttgcagtgtcaaaaatgggtggacatgcagaaacaggaagtggtggta
tttgagctttcaggaaatgaacacattcaaatgctatccaatgatactactatttcatat
gtgaaaaagctgctttttaatttgtga

DBGET integrated database retrieval system