KEGG   Meleagris gallopavo (turkey): 100544779Help
Entry
100544779         CDS       T01523                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100544779 (DBH)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100544779 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 629 aa AA seqDB search
MAKARRVGAILPSMQTHGSTPCPCPSFRLRELASMYFTMVAVFLVILVVALQGLVPRGTY
FPYKVPLDPQGLLELSWNVSYPEQAVYFQILIRKLKFGLLFGMSDRGEFENADLAVLWND
GHSSYFGDAWSDAHGQLHMDSQQDYQLLGAQKAPEGLYLLFRRAFSTCDPKDYLIEDGTV
HLIYGILENPVHSLRAINISTMYRGLQRVQLLKPNITIPELPNNVKTMEITTPNIVIPSQ
ETTYWCYIAKLPDSFAKHHIVMYEPVITAGNEALVHHMEIFQCTAEFDSIPQYNDLCDSK
MKPERLNYCRHVLAAWAMGAQAFYYPKEAGLAFGGPDSSRYLRLEVHYHNPLLFKGRRDS
SGIRLYYTANLRPHDAGIMELGLVYTPVMAVPPGETTFILTGYCTDKCTLQALPEDGIRI
FASQLHTHLAGRKVVTVLSRDGREQQVVNADGHYSPHFQEIRMLKELVAVFPGDELITTC
TYNTEDRNKVTVGGFGIMEEMCVNYVHYYPQTQLELCKSAVDPGYLHLYFNTVNRFNDEE
VCTCPKVSVPEQFSSIPWNAFNRDVLKSLYNFAPISVHCNKSSAVRFPGDWEKQPLPSIT
KTLREPQPHCPGPRPAVPVPINLSDIRRG
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagccaggagggtgggtgccatcctgcccagcatgcagacccatggcagcacg
ccgtgtccctgccccagcttcaggctgcgggagctggcatccatgtacttcaccatggtg
gctgtgttcctggtcatcctggtggtggccttgcagggcttggttccccgtggcacttat
ttcccctacaaggtgcccctcgatccccaggggctgctggagctctcatggaacgtcagc
taccctgagcaagctgtgtatttccagatcctcatcaggaagctcaagtttgggctcctc
tttgggatgtcggaccggggtgagttcgagaacgcagacctggccgtgctctggaatgat
ggtcacagttcatattttggggatgcctggagtgatgcccatgggcagctgcacatggat
tcccagcaggactaccagctgcttggggctcagaaggcccccgagggactgtaccttctc
ttcagaagagccttcagcacctgtgaccccaaggactaccttatagaggatggcaccgtg
caccttatctatgggatcctggagaaccccgtccattccctccgtgccatcaatatctct
accatgtacagagggctgcaaagagtgcagctgctgaagcccaacatcaccatccctgag
ctgcccaacaatgtgaagaccatggagataacgacccccaatattgttattcccagccag
gagacgacctactggtgttacattgcaaagctgccagacagctttgccaaacatcatatt
gtcatgtatgagccagtgatcacagcgggcaatgaagctctggttcaccacatggaaatc
ttccagtgcacagccgagtttgacagcatcccccaatacaacgatctgtgtgactccaag
atgaagccagagcgactcaactactgcaggcatgtgcttgcagcatgggccatgggagct
caggctttctactaccccaaagaagcagggcttgcctttggtggtccggactcctccaga
tatttgcgccttgaggttcactaccacaatccgctgttattcaaagggcgccgtgattcc
tcagggattcgcctctactacacagccaacctgcgtccccacgatgccggcatcatggag
ctgggcttggtctacacaccagtgatggctgtgcccccgggggagaccaccttcatcctc
actgggtactgcactgacaaatgcaccctgcaggcactgcctgaagatgggatccgcatc
ttcgcctcccagctccacactcacctggcagggcggaaagtggtgaccgtgctgtcacgg
gatggcagagagcagcaggtggtgaatgctgatgggcactacagcccacacttccaggag
attcgcatgctgaaggagttggtcgcagtctttccgggtgacgaactcatcaccacctgt
acctacaacacagaagacaggaacaaagtgactgtgggtgggtttggcatcatggaggag
atgtgcgtgaactacgtgcactactacccccagacacaactggagctctgcaaaagcgcc
gtggatccaggctatctgcacctctacttcaacactgtcaacaggtttaatgatgaggag
gtctgcacgtgcccaaaggtctccgtcccagaacagttctcctctattccttggaatgca
ttcaacagagatgtgctgaaatccctctacaactttgctcccatctcagtgcactgcaac
aaatcctcagctgtgcgcttcccgggtgactgggagaagcagcctcttcccagcatcacc
aagacactgcgggagccccagcctcactgcccagggcctcgtcctgccgtccctgtgccc
atcaacctgagtgacatcagaaggggctga

DBGET integrated database retrieval system