KEGG   Meleagris gallopavo (turkey): 100544793Help
Entry
100544793         CDS       T01523                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100544793 (USP9X)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100544793 (USP9X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2552 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNP
HCKFHLYNGTRPSETVPAGVQLAEDELYARPPDPRSPKGWLVDLINKFGTLNGFQILHDR
FMSGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDDELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLSAYMESMRQYAKEHGEYDPQTVRPGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ENNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
GNDDIANRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAIRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHITLVVRFPNQGRQVE
DLDIWSHTNDTIGQVRRCILNRIKANSAHTKVELFIGGELVDPADDRKLIGQLNLKDKTL
ITAKLTQINSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDNTTVEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPASAPLGEDASDFQYNFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPVVEGTSTISPINQATHDQAVVLQN
ALQNIPNPTSECMLRNVAIRLAQQISDEASKYIPDICVIRAVQKIVWASGCGSVQLVFSS
NEEISKIYEKTNAGNEPDMEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKIVRQMAQEQFFLMATRCCMGQRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDEVKRTGETGVEETILEGHLGVTKELLAF
QTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDTLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPAIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PHQYEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDDVNPENQIIQNEQSENEHSGST
KYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQCF
GGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTIDKDSELTKYISELAITTKPHQI
KMPSAIERSVRKQNVQFMHNRMQYSLEYFQFIKKLLTCNSVYLNPPPGQDHLLPEAEEIT
MISIQLAARFLFTTGFHTKKIVRGPASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFS
EYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAVL
NLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVALDEGPGPPIKYQ
YAELGKLYTVVSQLIRCCNVSSRMQSSINGNPPLTNPYGDPNLSQPIMALQQNVADILFV
RTSYVKKIIEDCSNSEETIKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLL
QILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPVA
YQILQSNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPIQSNETSNGYFLERSH
SARMTLAKACELCPEEEPDDPDAPDEHESSPPEDAPLYPHSPGSQYQQNNHVHGQPYTGP
AAHHMNNPQRTGQRAQENYEGSEEVSPPQTKD
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccggtaggaggcaatgatagccagggccaggctcct
gatggacagtcccagcctcccctccagcagaatcagacatcttcacctgattcttcaaat
gagaactctccagctaccccgcctgatgagcagggccaaggagatgctccacctcagctt
gaagatgaggagcctgcatttccacacacagacctggcaaagttggatgacatgatcaac
aggcctcgatgggttgttcctgtgttgccgaagggggaattagaagttcttctagaagct
gctattgacctgagtaaaaaaggccttgatgtcaaaagcgaagcgtgccagcgatttttt
cgagatgggttgacaatatctttcacaaaaatccttactgatgaggcagtgagtggctgg
aagtttgaaatccatagatgtattattaacaacactcatcgactagtagaactctgtgtg
gccaagctgtcccaagattggtttccccttcttgaacttcttgccatggccttaaatcct
cactgcaaattccatctatataatggtacacgtccctctgaaacagttcctgcaggagtc
cagcttgctgaagatgaactttatgcacgtcctcctgacccacgctcaccaaagggttgg
ctagtagatcttatcaacaagtttggcacattaaatggatttcagatcttgcatgatcgc
ttcatgagtggatcagcattgaatgttcagataattgcagctctcatcaagccatttgga
caatgttacgaatttctaacattgcacacagtgaagaaatacttccttccaattatagaa
atggttccacaatttttagaaaatctaacagatgatgaactgaaaaaagaagcaaagaat
gaagccaaaaatgatgctctatcaatgataatcaaatctctaaagaacttagcttcaaga
gttccaggacaagaagaaactgtaaaaaacttagaaatatttaggttaaaaatgattctt
aggttgttacaaatttcttctttcaatggtaaaatgaatgcactaaatgaagttaacaaa
gtaatatccagtgtatcgtattatactcaccggcatggtaatcctgaagaggaagaatgg
cttacagctgaaagaatggcagaatggatccagcagaataatattttatcaattgtgttg
agagacagtcttcatcaacctcaatatgtagagaagttagagaagattcttcgttttgtc
atcaaagaaaaagccctcactttgcaggatcttgacaacatttgggctgcacaggcagga
aaacatgaagccattgtaaagaatgtacatgacctccttgcaaaattagcttgggatttc
tctcctgaacagcttgatcacttgttcgattgttttaaggcaagttggacaaatgcaagc
aaaaaacagcgtgagaagctactcgagttaatccgtcgtctcgcagaagatgacaaggat
ggtgtgatggcacacaaagtgctgaaccttttgtggaatttggctcacagtgatgacgta
ccagttgatatcatggaccaggctcttagtgcccatattaaaatcttagattacagctgt
tcacaggatcgagatacacaaaagatccagtggatagatcgttttatagaagagcttcgc
acaaatgacaaatgggtcattcctgcactgaaacagattagagaaatttgcagtttattt
ggtgaagcaccacaaaacttgagtcaaacacagcgaagtccccatgtgttttaccgacat
gacttaatcaaccaacttcagcacaatcatgccctagtgacattagttgcggaaaatctg
tctgcctatatggaaagcatgaggcagtacgctaaagagcatggtgaatatgatccacaa
acggtaagaccaggaagcagatacagtcatgtgcaagaagtacaggagagacttaatttc
ttacgatttttattgaaggatggtcagctgtggctctgtgcccctcaggcgaagcaaata
tggaagtgtttagctgaaaatgctgtttatctttgtgatcgcgaagcctgttttaaatgg
tattccaaactaatgggggatgaaccagacttagaccctgacattaataaggacttcttt
gaaaataatgtgcttcagctggatccttccctattaacagaaaatggaatgaaatgtttt
gaacgtttcttcaaagctgtgaactgtcgagaaggaaagctagtagcaaagagacgagcc
tatatgatggatgatctggaattaataggattagactacctttggagggttgtgattcag
ggaaacgatgacattgcaaatagagcaattgatcttcttaaagagatctatactaacctt
ggtccacggttacaagttaatcaggtagtgattcatgaagacttcattcaatcctgtttt
gatcgtctcaaagcctcctatgatacattatgtgtgttggatggagataaagatagtatt
aattgtgcaagacaagaagcaataagaatggtgagggtgttgactgttttaagagaatac
ataaacgaatgtgacagtgattaccatgaagaaagaactattctacctatgtcaagagct
ttccgtggaaaacatatcacactggtagttcgttttccaaaccaaggccgacaggtggaa
gatttggatatttggtctcacacaaatgacacaattggccaagtgcggcgttgtattctc
aatcgtattaaagccaacagtgcgcacacgaaagtagaactgttcattggtggtgagctg
gtggatcctgcagatgataggaaattaataggacaattgaatctcaaagataaaacgcta
attacagctaagcttacacagataaattctaatatgccctcaagtcccgatagttcttct
gactcttcaactggttctccgggcaaccacggcaatcactacagcgatggtccaaaccca
gaagttgaaagctgtttgcccggagtgatcatgtcactgcatcctcgatacatttctttt
ctttggcaagttgcagacttgggcagtagcctaaatatgccacctcttagagatggagca
cgtgttcttatgaagctcatgccaccagataacactacagttgagaaactaagagctatt
tgtttagatcacgcaaaacttggagaaagcagccttagtccatcccttgactctctattt
tttggtccctctgcctcacaagtgctatatctaacagaggtagtttatgccttgttaatg
cctgccagtgcacctctgggagaagatgccagcgacttccagtacaacttcttaaaaagt
ggtggtttgcctcttgtattgagtatgctgactcgaaataacttcctgccaaacgcagat
atggaaactcgaaggggtgcctaccttaatgctctaaaaatagccaagttattgctaaca
gcaattggatatggccatgttcgagctgtggcagaagcttgtcaaccagttgtggaaggc
acaagtacaatttcaccgataaaccaggctacacatgaccaggcagtggtgctacaaaat
gccctacaaaacattcctaatccaacttcagaatgcatgctaagaaatgtagcaatacgt
cttgcacagcaaatatctgatgaggcttcaaaatatatacctgatatctgtgttattagg
gcagtgcaaaaaattgtctgggcgtctggttgtgggtcagttcaacttgtgttcagttct
aatgaggaaatcagtaaaatctatgaaaagacaaatgcaggaaatgaaccagatatggaa
gatgaacaagtttgctgtgaagcattggaggtgatgaccctatgttttgctttgattcca
acagcactggatgctctaagtaaagaaaaagcatggcagacgtttatcattgatttgcta
ttgcactgtcacagcaaaattgttcgtcaaatggcacaggagcagttcttcttaatggct
accaggtgttgcatgggacagagacctctccttttcttcattactctgctgtttacagtt
ctagggagtactgctagagagagagctaagcattctggagactacttcactctgttaaga
catcttcttaactatgcctacaacagtaatattaatgtgcccaatgctgaagttcttctc
aataacgaaattgactggctgaaaaggatcagggatgaagtaaaaaggacgggggaaaca
ggtgttgaagaaaccatcttagagggtcaccttggagtaacaaaagagttgctagcattc
cagacacctgagaagaaataccatattggttgtgaaaaaggaggtgctaatctcattaaa
gaattgatagatgatttcatctttccagcatccaatgtttatttacaatacatgaggaat
ggagaattgcctgctgagcaggccataccagtctgtagttcaccagctactattaatgct
ggctttgagctactagttgcactagcagttggatgtgtccgaaatctcaaacagatagta
gacaccttgactgagatgtattacataggtacagcaatcactacttgtgaagcgcttaca
gaatgggaatatctaccacctgttgggcctcgaccaccaaagggatttgtaggattaaaa
aatgctggtgccacttgttacatgaattctgttattcagcagctgtacatgattccagcc
atcaggaatgggattcttgcaattgaaggcacaggcagtgatgtagatgatgatatgtct
ggggatgaaaagcaggacaatgagagcaatgttgacccgcgagatgatgtgtttggctac
ccacatcagtatgaggacaaaccagcactgagtaaaacagaagacagaaaagagtacaat
attggagtcctgagacatctccaagtaatttttggtcatttagcagcttccaggctacaa
tactacgtaccaagagggttttggaaacaatttagactctggggtgaacctgtaaatctg
cgtgaacaacatgatgctttagaattctttaattccttggtggatagtttagatgaagct
ttgaaagctttgggccatccagcaatgttaagtaaagttttaggaggatcctttgctgat
cagaagatttgtcaaggatgccctcataggtacgaatgtgaggaatccttcacaactctg
aatgtagatataagaaatcaccaaaaccttcttgattctttggaacagtatgtcaaggga
gatctattggaaggtgcaaatgcatatcattgtgaaaaatgcaacaaaaaggttgacaca
gtgaaacgcttgttgattaagaagttgcctccagttcttgccatccagttgaagcgattt
gattatgactgggaacgggaatgtgcaatcaagttcaatgactattttgaatttccgaga
gagctggacatggagccttacacagtagcaggtgtagctaaattggaaggagatgatgta
aatcctgaaaatcaaataatacaaaatgaacagtcggaaaatgaacattctgggagcaca
aaatacaggctcgttggtgtgcttgtacatagtggccaggccagtggtggacattattac
tcttacattatccagagaaatggtggagatggtgagaaaaatcgatggtataaatttgat
gatggagatgtgacagagtgtaaaatggatgatgatgaagaaatgaaaaatcagtgtttt
ggtggagagtacatgggagaagtatttgatcatatgatgaagcgtatgtcctacagacgt
cagaagaggtggtggaatgcttatattcttttttatgaacgtatggacacaatagacaaa
gacagtgaactaacaaaatacatttcagaacttgctatcaccactaaaccacatcaaatt
aaaatgccatcagccatcgagcgaagcgtacggaaacagaacgtgcagttcatgcataat
cgtatgcagtacagcctggagtacttccagtttataaagaagttgcttacttgtaatagt
gtctacttaaatcctcctccaggacaagatcatctgttgccagaagcagaagaaataact
atgattagcattcaacttgctgctagatttctcttcaccacaggatttcatacaaagaaa
atagtccgtggcccagctagcgattggtatgatgcattatgcattcttctccgtcacagc
aagaatgtacgcttttggtttgcacacaatgtcctttttaatgtttcaaaccgcttctct
gagtaccttttggaatgccctagtgctgaagtgaggggtgcattcgcaaaacttatcgta
tttattgcacatttttcgttgcaagatggaccatgtccttcaccttttgcctctcctgga
ccttccagtcaggcttatgataacttaagtttaagtgatcacttactgagagcggtacta
aatcttcttcgaagggaagtatctgaacacgggcggcatttgcagcagtatttcaatctg
tttgtgatgtatgccaatctaggtgtagcagagaagacacaacttctgaaactaaacgtt
cctgcaaccttcatgcttgtggctctggatgaaggtccaggcccaccaattaagtaccag
tatgctgaactggggaagctgtacactgttgtgtcgcaactgatccgatgttgcaatgta
tcatcgcggatgcagtcttctatcaatggtaatcctccacttaccaacccctacggtgat
cctaatttatctcaaccaataatggcacttcagcagaacgtagcagacattttgtttgtg
agaaccagttatgtgaagaaaattattgaagattgcagcaattctgaagagaccatcaaa
ttgcttcgtttctgctgttgggagaatcctcagttctcttccactgtcctaagtgaactt
ctctggcaggttgcatattcatacacatacgaacttcgaccttacttggatctgcttctg
caaatcctattaattgaggattcttggcaaactcacaggattcacaatgcacttaaggga
atcccagatgacagggatggactatttgacaccattcaacgctccaagaaccattatcag
aaacgagcttaccagtgtataaaatgcatggtagccctcttcagcaactgccctgtagcc
taccagatccttcagagtaatggagatttgaagagaaaatggacctgggcagtagaatgg
cttggagatgagcttgagcgtagaccatacactggcaatcctcaatacacctacaataat
tggtctccacctatacaaagcaatgaaacatcaaatggctacttcctagagagatcacac
agtgctagaatgactcttgcaaaagcttgtgaactctgcccagaggaggaaccagatgat
cctgatgctccagatgaacatgagtcttctccacctgaagatgcaccactgtatccccat
tcacctggttcccagtatcaacagaataaccatgtgcatggacagccatatacaggcccg
gcagcacatcatatgaacaaccctcagcgaactggccaacgagcacaagaaaactatgaa
ggcagtgaagaagtttccccgcctcagacaaaagattag

DBGET integrated database retrieval system