KEGG   Meleagris gallopavo (turkey): 100544821Help
Entry
100544821         CDS       T01523                                 

Definition
carboxypeptidase B-like
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 417 aa AA seqDB search
MWAFLVLVGAAVASAHLQDLTFDGHKVFRVIPQNDEQVEIIHSLASKMQVDFWQPDYVNL
VKPKMQVDFRVEADKALEVEHLLKENKMDYKVLIDNLQTALHAQFDSKVRSTGHSYEKYN
TWDKIAAWTADIAAQNPNLVSRSVIGETYEGRPLYLLKLGKSGTNKKAIFMDCGFHAREW
ISPAFCQWFVKEAVETYGTDSTMTKLLNSLDFYVLPVVNIDGYVYTWTNDRMWRKTRSKN
TGSICIGTDPNRNFNAGWCKLGASNRPCDSTYCGSSPESEKETKALADFIREHLSTIKAY
LTIHSYSQLLLFPYSYTYALPQDYNELNTIASAATEKLTSLYNTKYVYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDTGNYGFLLPESQIKPTCEETLLAVKYIASYVLDHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgttcttagttctcgtaggtgctgcagtggcttctgctcacctgcaagatctg
acttttgatggccacaaggtgtttcgcgtgattccacagaatgatgagcaggtggaaatc
atccattcccttgccagcaaaatgcaggttgacttttggcagccagactacgtcaatctg
gtaaagccaaaaatgcaagttgatttccgagttgaagctgacaaggctttggaggttgaa
catctcttgaaagaaaacaaaatggattataaagttctgattgacaacctgcagactgca
ctgcatgctcagttcgacagcaaagttcgtagcactggtcacagctatgaaaaatacaac
acctgggataagatagctgcttggactgctgacattgctgctcagaacccaaacctggtc
tctcgcagtgtaattggggaaacatacgaaggacggccactgtaccttctcaaattggga
aaaagcggtacgaataagaaggccatcttcatggactgtggtttccatgcaagagagtgg
atctcccctgctttctgccagtggtttgtgaaagaagctgttgagacctatggaacagat
agtaccatgaccaaacttctcaacagcttggacttctatgttttgccagttgttaatatt
gatggttacgtttacacttggacaaatgaccgtatgtggagaaagacacgctctaaaaac
actggcagcatttgcattggtaccgatcccaacaggaatttcaatgctggctggtgcaaa
cttggggcctcaaatagaccctgtgattccacttactgtggctcctcacctgagtctgaa
aaggagacaaaggctttggctgattttattcgtgaacatctttctacaatcaaggcatac
ctgactattcactcctattcccagctgctactgtttccttattcatacacttacgcactt
ccacaggattacaacgaactgaacaccattgctagtgctgcaaccgaaaaactgaccagt
ttgtacaacaccaaatacgtatacggcccaggagctacaacaatctaccctgctgcagga
ggctctgatgactgggcttacgatcaaggcatcaagtactctttcacttttgagctccgt
gacaccggtaattatgggtttcttctgcccgagtctcagataaagccaacctgtgaggag
actctgcttgctgttaaatacattgccagttatgtccttgatcacttgtattaa

DBGET integrated database retrieval system