KEGG   Meleagris gallopavo (turkey): 100544825Help
Entry
100544825         CDS       T01523                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100544825
Peptidases [BR:mgp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100544825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 236 aa AA seqDB search
MSILSLMVSLVLMGTEPGCDRSLRQRYGNFHFCGGSLISEEWVVTAAHCGVRTTDTVVLG
EYDQETASSDVQRLGVAKVFRNPNYSALTIRNDIALIKLATPAQLNARVAPVCLPQATDD
FPGGLTCVTTGWGLLNANDANTPAILQQAALPLLTNAQCKQYWGFRIYDVMVCAGADGAS
SCSGDSGGPLVCQKDGAWTLVGIVSWGSSTCSTSVPAVYARVTELREWIDSVLAAN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcctgtcactaatggtgtccctggtgttgatggggactgagccaggatgtgac
cgctctctccggcagcgctatggcaacttccacttctgtggtgggtcgctgatcagcgag
gaatgggtggtcaccgctgcccactgtggggtcaggaccaccgacaccgtggtgctgggc
gagtacgaccaggagacggcctccagtgatgtgcagaggttgggcgtcgccaaggtcttc
cggaaccccaactacagcgcgctgaccatccgcaacgacatcgcgctgatcaagctggcc
accccagcgcagctgaacgcccgcgtggcgcccgtctgcctgccccaggccaccgacgac
ttccccgggggcctgacctgcgtcaccacgggctgggggctcctcaacgccaacgatgca
aacacgccggccatcctgcagcaagcggcccttcccctgctcaccaacgcgcagtgcaag
cagtactggggcttccgcatctacgacgtgatggtgtgcgccggggccgatggagcctcc
tcctgctcgggtgactccgggggcccactggtgtgccagaaggacggcgcctggacgctg
gtgggcatcgtctcgtggggcagcagcacctgctccacctctgtgcccgctgtctacgct
cgtgtcaccgagctccgcgaatggatcgactccgtgctggcggccaactga

DBGET integrated database retrieval system