KEGG   Meleagris gallopavo (turkey): 100544828Help
Entry
100544828         CDS       T01523                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4-like
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Influenza A
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100544828
   04012 ErbB signaling pathway
    100544828
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100544828
  Endocrine system
   04912 GnRH signaling pathway
    100544828
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100544828
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100544828
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100544828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 368 aa AA seqDB search
MKIPNGEGKRKALKLNFANPPFKSTARFTLNTSGVPFQNPHIERLRTHSIESSGKLKISP
EQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDV
VMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLA
TVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMA
PERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNS
EEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERTVDVACYVCKILDQMPAT
PSSPMYVD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagataccaaatggggaaggtaaacgcaaagcgctgaagttaaattttgcaaatcca
cctttcaagtctacggcaagatttactctaaacacttcaggagttcctttccaaaatcca
cacatagagagactgagaacacacagcattgaatcatcaggaaaattgaagatttcccct
gaacagcattgggattttacagcagaggacttgaaagaccttggagaaattggacgaggc
gcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaattatggcagttaaa
agaattcggtcgacagtggatgaaaaagaacagaagcagcttctgatggaccttgatgta
gtaatgcgaagcagtgactgcccatatattgttcagttttatggtgcactcttcagagag
ggtgattgttggatctgtatggagctcatgtctacctcgtttgataagttttacaaatat
gtatatagtgtattagatgatgttattccagaagaaatcctaggcaaaatcactttagct
actgtgaaagcactaaaccacttaaaagaaaacttgaaaatcattcacagagatatcaaa
ccttccaatattcttctggacagaaatggaaatattaaactctgtgacttcggcattagt
ggacagcttgtggactccatcgccaaaacacgagatgcggggtgccggccgtacatggcg
ccggaaaggatagatcccagcgcatccaggcaaggctatgatgtccgctcagatgtctgg
agcttggggattacactgtatgagctggccacagggcgattcccgtaccccaagtggaac
agtgtgtttgaccagttgacgcaagtagtaaaaggagacccaccacagctgagtaactca
gaggaaagggaattctccccaagtttcatcaacttcgtcaacttgtgccttacaaaggac
gagtccaaaaggccaaagtacaaagagcttctgaaacatcccttcattctgatgtatgag
gaacgcacagtggatgttgcatgctatgtttgtaaaatcctggatcaaatgccagcaact
cccagctctccaatgtatgtcgattga

DBGET integrated database retrieval system