KEGG   Meleagris gallopavo (turkey): 100544831Help
Entry
100544831         CDS       T01523                                 

Definition
AP-1 complex subunit beta-1-like
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100544831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 937 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTATTNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLVGQTYIPSSVPATFAPSPTPAVVSSGLNDLFELSSGIGMAPGGYVAPKSVWLPAVKA
KGLEISGTFSHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT
WKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL
AELRIQPGNPNYTLSLKCRAPEVSQYIYQAYDAILKN
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgacggactccaaatacttcacaaccaataaaaaaggagagatttttgaactgaaggct
gaactcaataatgaaaagaaggagaaaaggaaagaagctgtaaagaaggttattgcagcc
atgactgtggggaaggatgtcagctcgctctttcctgatgttgtgaactgtatgcagact
gacaacctggagttgaagaagctggtgtatctgtacctgatgaactacgccaaaagtcag
ccagacatggccattatggctgtcaacagctttgtgaaggactgtgaagatccaaaccct
ctcatccgtgctctggccgtccgtaccatgggatgcatcagggtggacaagatcacagag
tacttgtgtgagcctcttcgcaagtgtctgaaggatgaagacccttatgttcgtaagact
gcagctgtctgcgtggccaagctgcatgacatcaatgcccagatggtggaggaccaggga
tttctggattctctgcgtgacctgattgcagactcgaatcccatggtggtagcaaatgct
gttgctgctttgtcagaaatcagcgagtctcatcccaacagcaacctgctggacctgaac
cctcagaacatcaacaagctgctgacagctttaaatgaatgcacagaatgggggcagatc
ttcattctggactgcctgtccaactacaaccccaaggatgatcgtgaagctcaaagtatt
tgtgagcgagtgactcctcggctgtcccatgccaactcagcagtggtgctgtcagcagtg
aaagttctgatgaagttcctggagcttctccccaaggactcagattattacaacatgctg
ctgaagaagcttgcccctccactggttaccttgctgtctggagagcctgaagtccagtat
gttgccctgaggaacatcaacttgattgtgcagaaaaggcctgaaatcctgaagcaggaa
atcaaggtgttctttgtgaagtacaacgatcctatctatgtcaagctggagaaactggac
atcatgattcgcctggcttctcaagcaaacattgcccaggtccttgcagagctgaaggaa
tatgctactgaggtggatgttgactttgttcgcaaggctgttcgagctatcggacgctgt
gccatcaaggttgagcaatctgcagagcgctgtgtgagcacactgctagacctcattcag
accaaggtcaactacgtcgtccaggaggccattgtggtcatcagggacatcttccgcaag
taccccaacaagtatgaaagcatcattgccacattgtgtgagaacctagattccctggat
gagccagatgccagagctgccatgatctggatcgtgggtgaatacgcagaacgaattgac
aatgcagacgaactgttggagagttttctggagggctttcatgacgaaagtactcaggtg
cagctcacccttctgactgctatagtgaagctgttcttaaaaaagccttctgagacacag
gagctggttcagcaggtcctcagcctggccacacaggattctgacaacccagacctgcgg
gaccgtggctacatctattggcgccttctttccacggacccagtgactgccaaagaagtg
gtcttatcagaaaagccactgatctctgaggagactgatctgattgaacccactctgctg
gatgagctgatctgccatattgggtctctggcttctgtgtaccacaaaccgcccaatgct
tttgtggaagggagccatggtatccaccgcaagcacttgccaattcaccatggaagcact
gatgcaggagacagccctgtggggacaacagccacaacaaacctggagcagccacaggtc
atcccatcgcaaggcgacctgctgggtgacctgctcaacctggacctgggaccccctgtc
aacgttccccaggtgtcctccatgcagatgggtgccgtggacctactgggaggagggttg
gacagcttggtggggcagacctacattccctcttctgtgccagccacttttgccccttca
cccacaccagctgtggtgagcagtggactcaacgatctctttgagctctcatctggtata
ggcatggctcccggcggatatgtggctcccaagtctgtttggttgcctgcagtgaaagct
aaaggactggagatctcaggcacattcagtcataggcagggacacatctacatggagatg
aacttcaccaataaggctttgcagcacatgactgactttgccattcagttcaacaagaac
agctttggggtcatcccaagcactccgttggccattcacacccctctgatgccaaaccaa
agcattgatgtctctctgcccctcaacaccctgggaccagtcatgaaaatggagcctctg
aacaacctccaggtagctgtgaaaaacaacattgatgtcttttacttcagctgcctaatt
cctctcaacgtgctttttgtggaggatggcaaaatggagcgccaggtcttcctcgcaact
tggaaagacattccaaatgaaaatgagctgcagttccagattaaagactgccacctgaat
gctgacactgtctccagcaaactgcagaacaacaacgtctacaccattgccaagaggaac
gtggagggtcaggacatgctctaccagtccctcaagctcaccaatggcatctggatcctg
gctgagcttcgcatccagccaggcaatcccaattacacgctttctctgaaatgccgtgct
cccgaggtgtcccagtacatctaccaggcctacgatgccatcctgaagaactga

DBGET integrated database retrieval system