KEGG   Meleagris gallopavo (turkey): 100544844Help
Entry
100544844         CDS       T01523                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100544844
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100544844
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100544844
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100544844
  Exosomal proteins of breast milk
   100544844
Heparan sulfate/heparin binding proteins [BR:mgp00536]
 Enzymes (General comment) Variety
  100544844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Z
AA seq 265 aa AA seqDB search
MGKTALLAVLCLCVHGASGSDLEAEMNFEGIESKFSLRTPAEPDEDVCYLIPGQMDSLAQ
CNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQQHYPVSAA
YTKLVGKDVAMFIDWMEEKFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAG
PTFEYADAPIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLG
EALRLIAEKGFSDVDQLVKCSHERS
NT seq 794 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaacggcgctgctggccgtgctctgcctctgtgtgcacggggcctctggcagt
gatttagaagctgagatgaattttgaggggattgagagcaagttttccttaagaacacct
gcagagcctgatgaggatgtctgctacctgattcctgggcagatggacagcttggcacag
tgcaatttcaaccataccagtaaaacctttgtggtgatccatggctggacggtgacagga
atgtatgaaagctgggtcccaaagctggtggatgctctgtacaagagggaacctgattca
aatgttatagttgtggactggctggttcgagctcagcagcactacccagtgtctgctgct
tacacaaagctggtgggaaaggatgttgctatgtttattgactggatggaggagaaattc
aattaccctctcaacaatgttcacttgctggggtacagtctgggtgctcatgctgctggg
attgctgggagcctaaccaagaagaaggtgaacagaattactggtctggatcctgctggt
cccacctttgagtatgctgatgcccctatccgcctctccccggatgatgctgactttgtg
gatgttctgcacacctacactcgaggctctccagatcgcagtattgggattcagaaacct
gttggacacatcgatatttaccctaatggtggaggtttccagccaggctgcaacttgggg
gaagctctccgcctgattgctgaaaaaggcttttcagatgtggatcagctggtgaagtgc
tctcatgagcgatc

DBGET integrated database retrieval system