KEGG   Meleagris gallopavo (turkey): 100544844Help
Entry
100544844         CDS       T01523                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mgp00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mgp03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Z
AA seq 265 aa AA seqDB search
MGKTALLAVLCLCVHGASGSDLEAEMNFEGIESKFSLRTPAEPDEDVCYLIPGQMDSLAQ
CNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQQHYPVSAA
YTKLVGKDVAMFIDWMEEKFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAG
PTFEYADAPIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLG
EALRLIAEKGFSDVDQLVKCSHERS
NT seq 794 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaacggcgctgctggccgtgctctgcctctgtgtgcacggggcctctggcagt
gatttagaagctgagatgaattttgaggggattgagagcaagttttccttaagaacacct
gcagagcctgatgaggatgtctgctacctgattcctgggcagatggacagcttggcacag
tgcaatttcaaccataccagtaaaacctttgtggtgatccatggctggacggtgacagga
atgtatgaaagctgggtcccaaagctggtggatgctctgtacaagagggaacctgattca
aatgttatagttgtggactggctggttcgagctcagcagcactacccagtgtctgctgct
tacacaaagctggtgggaaaggatgttgctatgtttattgactggatggaggagaaattc
aattaccctctcaacaatgttcacttgctggggtacagtctgggtgctcatgctgctggg
attgctgggagcctaaccaagaagaaggtgaacagaattactggtctggatcctgctggt
cccacctttgagtatgctgatgcccctatccgcctctccccggatgatgctgactttgtg
gatgttctgcacacctacactcgaggctctccagatcgcagtattgggattcagaaacct
gttggacacatcgatatttaccctaatggtggaggtttccagccaggctgcaacttgggg
gaagctctccgcctgattgctgaaaaaggcttttcagatgtggatcagctggtgaagtgc
tctcatgagcgatc

DBGET integrated database retrieval system