KEGG   Meleagris gallopavo (turkey): 100544844Help
Entry
100544844         CDS       T01523                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100544844 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100544844 (LPL)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100544844 (LPL)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100544844 (LPL)
  Exosomal proteins of breast milk
   100544844 (LPL)
Glycosaminoglycan binding proteins [BR:mgp00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100544844 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Z
AA seq 490 aa AA seqDB search
MERGREMGKTALLAVLCLCVHGAAGLDPEAEMNFEGIESKFSLRTPAEPDEDVCYLIPGQ
MDSLAQCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQQH
YPVSAAYTKLVGKDVAMFIDWMEEKFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRIT
GLDPAGPTFEYADAPIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQ
PGCNLGEALRLIAEKGFSDVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKG
LCLSCRKNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNVTKVDQ
PFLISLYGTLDESENIAFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSDW
WTPFAFTIQRVRVKSGETQKKVVFCSRDGSSRLGKGEEAAIFVKCLEQPVSRKRGGAKKA
SKENSAHESA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggagagaggacgcgagatggggaaaacggcgctgctggccgtgctctgcctctgtgtg
cacggggccgccggcttagatcccgaagctgagatgaattttgaggggattgagagcaag
ttttccttaagaacacctgcagagcctgatgaggatgtctgctacctgattcctgggcag
atggacagcttggcacagtgcaatttcaaccataccagtaaaacctttgtggtgatccat
ggctggacggtgacaggaatgtatgaaagctgggtcccaaagctggtggatgctctgtac
aagagggaacctgattcaaatgttatagttgtggactggctggttcgagctcagcagcac
tacccagtgtctgctgcttacacaaagctggtgggaaaggatgttgctatgtttattgac
tggatggaggagaaattcaattaccctctcaacaatgttcacttgctggggtacagtctg
ggtgctcatgctgctgggattgctgggagcctaaccaagaagaaggtgaacagaattact
ggtctggatcctgctggtcccacctttgagtatgctgatgcccctatccgcctctccccg
gatgatgctgactttgtggatgttctgcacacctacactcgaggctctccagatcgcagt
attgggattcagaaacctgttggacacatcgatatttaccctaatggtggaggtttccag
ccaggctgcaacttgggggaagctctccgcctgattgctgaaaaaggcttttcagatgtg
gatcagctggtgaagtgctctcatgagcgatccatccatctctttattgactcgctcctc
tatgaagagaagcccagcatggcctaccgctgcaacacaaaagaggcctttgagaagggc
ctctgcctaagctgccggaagaaccgttgcaacaacttgggttataaagtcaacagagtg
agaacaaagagaaacaccaaaatgtacttgaagacccgcgctcagatgccctacaaagtc
ttccattatcaggtcaagatacatttctttggaaagaccaatgtgaccaaggtagaccag
ccattcctgatttctctgtatggcactctagatgagagtgagaacattgctttcacactg
cctgaagtctcttctaacaagaccttctccttcctgatctacacagaagtggacattggt
gacctgcttatgctaaagctgcagtgggagaaagataccttcttcagctggtcagactgg
tggactccatttgcattcaccatccagagagtcagagtgaagtcaggcgaaactcagaaa
aaggtggtattctgttctcgagatggcagctcacgtcttggtaaaggagaagaggcagca
atatttgtgaagtgccttgagcagcctgtcagcaggaagaggggaggtgccaagaaagcc
tctaaagaaaattctgcacatgagtctgcttaa

DBGET integrated database retrieval system