KEGG   Meleagris gallopavo (turkey): 100545004Help
Entry
100545004         CDS       T01523                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100545004
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100545004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 311 aa AA seqDB search
MDSSDKCVSGINIPEESAGFTTRLPRAGETILGQKFFIGFGGKGANQCVQSARLGAKTSL
ICKVGKDSFGNDYVANLKKNGVSTAFVGQTADAVTGTASIIVNSEGQNVIVIVPGANLLL
NSEDLKRASDIICKAKVVVCQLEITPAVSLEALKMARASGVKTLFNPAPALADLDPEFYT
HSDIFCCNETEAEILTGIPVGNLEDAEKVGRMLLERGCKLVIVTLGAEGCMMISVEEPIP
KHVPAEKVRAVDTTGAGDSFVGALAFYLAYYPKLPMEEMVRKSNYIASVSVQASGTQSSY
PYRKDLPQDLF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagtgacaaatgtgtatcaggaattaacatcccagaggagtctgctggcttt
accacgagattgccaagagctggagaaactatcctcggacagaagtttttcattggtttt
ggtgggaaaggagccaatcagtgtgtccagtctgctcgacttggggccaagacctctctg
atctgcaaggttgggaaggattcctttggcaatgattatgttgcaaatttgaagaagaat
ggtgtttctacagcatttgtaggtcagactgcagatgctgttactggaactgcttcaata
attgtcaacagtgaaggacagaatgttattgtcatagttccaggagccaatctgctttta
aattctgaagacctgaagagagcttctgatatcatctgtaaagccaaagtggttgtctgc
cagctagaaataacccctgctgtttctcttgaagcgctgaaaatggcacgtgctagtgga
gtaaaaaccttgtttaaccctgctccagcccttgctgacctagatccagaattttatacc
cactctgacatcttctgctgcaatgaaactgaggcagaaattttaacgggcatcccagtt
ggcaaccttgaagatgctgaaaaggtgggacgcatgctgttagaaagagggtgtaagctc
gtaattgttactcttggagcagaaggctgcatgatgatatcagtagaagaacccattcca
aagcacgttcctgctgagaaggtcagggctgtggacactacgggagctggagacagtttc
gtgggagcactggccttctacctggcttactatcccaagctgcccatggaggaaatggtc
aggaagtctaactacattgcatcagtgagtgtccaggcatcagggacacaatcttcatat
ccttacaggaaggacttgcctcaggaccttttctaa

DBGET integrated database retrieval system