KEGG   Meleagris gallopavo (turkey): 100545064Help
Entry
100545064         CDS       T01523                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100545064
Enzymes [BR:mgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100545064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 268 aa AA seqDB search
MKVLLLKDPKDKESGPDPYVKELGLCGFEATLIPVLSFEFVSLEDLFEKLSHPERYGGLV
FTSPRALEAIKICLREKSKNEAWSKSLKQQWNTKPTYVVGKATASLVEEIGLSPQGEKSG
NAEKLAEYICSKKPHSSSLLFPCGALKREVLPTALKEKGIPLESLTVYQTAQHEHLQQSL
SSYFSQQGIPASIVFFSPSGVKFCLQHIQKLSGDSANQIKFAAIGPTTAEAMEAAGIPVS
CTAESPTPQDLAAGIQKALRPQNCILSE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctgttattgaaggaccccaaagacaaagagtcgggaccagatccatatgtg
aaagaattaggattgtgtggatttgaagcaactttgattccagttttgtcatttgaattt
gtatctcttgaagacttgtttgaaaagctttctcatccagagcgttacgggggcctcgtt
tttaccagtccaagagcattagaagccatcaagatatgtttaagagagaagagtaaaaat
gaagcatggtcaaaatctcttaaacaacagtggaataccaaaccaacatacgtggtagga
aaggctacagcttctcttgtggaagaaattggcctttctccacaaggagaaaagagtgga
aatgctgaaaaattggctgaatatatttgttcaaagaaacctcattcatcatctcttctt
tttccttgcggagccctgaaaagagaagtacttcctacagcgcttaaagaaaaaggcata
ccgctggagagcctgactgtgtaccagactgcccaacacgagcatctccagcagtcactg
agcagctatttctcacagcagggaattccagccagcatcgtgttcttcagtccatctggt
gtcaagttttgcctccagcacattcagaagctttctggtgattctgccaaccaaataaag
tttgctgctatcggtccaacaactgctgaagccatggaagcagcaggaatcccagtaagc
tgcactgcagagagtcccactcctcaagacctcgctgctgggatccaaaaagcacttcgc
ccacagaactgcattttatctgagtga

DBGET integrated database retrieval system