KEGG   Meleagris gallopavo (turkey): 100545067Help
Entry
100545067         CDS       T01523                                 

Gene name
USP24
Definition
(RefSeq) ubiquitin specific peptidase 24
  KO
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100545067 (USP24)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100545067 (USP24)
Ubiquitin system [BR:mgp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100545067 (USP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 1695 aa AA seqDB search
MKKNDENGNCSGEGIEFPTTNLYELESRVLTDHWSIPYKREESLGKCLIASTYLARLGLS
DSDENCKRFMDRCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLVDLVAERVKQDPIPV
GLLGVLTMAFNPDNEYHFKNRMKVCQRNWAEVFGEGNMHAVSPISTFQKEPHGWLVDLVN
RFAELGGFSAIQSKLNSEDIELGAISALVQPFGVCAEYLNSSVVQPMLDPVIHKMIKYVQ
NVEEKDLKDKRLVSIPELLSGIKLLCMRFQPDLVTAVDDLRLDILLRMLKSPHFSAKMNS
LKEVTKLIEDSTVSKSVKNAIDTDRLLNWLVENSVLSIALEGNIDQAQYCDRIKGIIELL
GSKLSLDELTKIWRIQSGQSSTVIENIHTIIAAAAVKFSSDQLNHLFVLIQKSWETESDR
VRQKLLSLIGRIGREARVETTTGKVLEVLWELAHLPTLPCSLIQQALEEHLTILSDAYAV
KEAIKRSYIIKCIEDIKRKMKPARKAMSSSNNESSQHNNPQFVWVVPALRQLHEITRSFI
KQTYQKQDKSIIQDLKKNFEIVKLVTGSLISCHRLAASVAGPGGLVGATLVDGRYTYREY
LEAHLKFLAFFLQEATLYLGWNRAREIWECLVTGQDVCELDREMCFEWFTKGQHDLESDV
QQQLFKEKILKLESYEITMNGFSLFKTFFENVNLCDHRLKRQGTQLSVEKLELIGMDFIW
KIAMESPDEEIANEAIQLIINYSYINLTPRLKKDSVSLHKKFIADCYTRLEAASSALGGP
TLTHAVTRATKMLTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDLYSVPRT
ILPHGASFHGHLLTLNVTYESTKDTFTIEAHSNETVGSIRWKIAKMLNSPVDNIQIFAND
SLLTVNKDQKLLHQLGFSDEQVLTVKTSGSGTPSGSSADSSTSSSNSSSVFSSSYAMEQE
KSLPGVVMALVCNVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKK
TLLSESGSQSSKSPSLSSKHQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPT
ADDEMARNCAKSFCENFLRAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLV
GQTMPTLLDEDFIKDGVEALSSRPFRNVSRQASRQMSICGTPEKSSYRQLSVSDRSSIRV
EEIIPAARVAIQTMEVNDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKENNTLFPAGIRN
RLSSSGSNCSSGSEGEPTALHAGICVRQQSVSTKDALIAGEALSLLVTCLQLRSQQLGSF
YNLPCVADFIIDILLGSPSAEIRRVACDQLYTLSQTDTSTHPDVQKPNQFLLSVILGAQL
PLWSPTSIMRGINQRLLSQCTEYFDLRCQLLDDLTSSEMEQLKISPAAMLEDEITWLENF
EPNRTAECETSEADNILLAGHLRLIKTLLSLCGAEKEMVGSSLIKPLLDDFLFRASRIIL
NSHSPAGSAAISQQDFHPKCSTADSRLAAYEVLVMLANSSPSNLQLITKELLSMHHQCDP
ALTKEFDYLPPVDSRSISGFVGLKNGGATCYMNAVFQQLYMQPGLPEALLSIDDDTDNPD
DNVFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEY
LKVKSSGIFFPIYMH
NT seq 5085 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatgatgaaaatgggaattgctctggagaaggcattgagtttccaacaacc
aacttgtatgagctagagagcagagttctaacagatcactggtccataccctataagcgg
gaggaatctctaggcaagtgcctgattgcatccacatatctagcaagactgggtctttct
gattctgatgagaattgcaagagatttatggacagatgcatgccagaagcatttaaaaag
ttgctgacatccagcgctgttcacaaatggggaactgaaatccacgaagggatatacaac
atgcttatgctgctagtagacctggttgcagaaagagtaaagcaagatcctattcctgtg
ggcctgcttggtgtgcttacaatggcatttaaccctgacaatgagtatcatttcaagaat
cgaatgaaggtttgccagagaaactgggcagaagtctttggggaggggaacatgcacgct
gtgtcacccatatccacgtttcagaaggaacctcatgggtggctggtggatctggtaaac
aggtttgcagagttgggtggattttcagcaattcagtccaaactcaattcagaagatatt
gagcttggggcaatctctgcattagttcaaccatttggagtttgtgcagaatatcttaac
tcttctgtagtacagcccatgctggatccagtcattcataaaatgattaaatacgtgcag
aatgtagaagagaaggacttgaaagacaagagactagtcagtatccctgagctcctgtct
ggtattaaactgctgtgtatgcgcttccaacctgatttggtgactgcagtggatgactta
cggctggatattctgctgcgcatgttgaaatcgcctcacttcagtgcaaaaatgaattcc
ctcaaagaagtaaccaaattaatagaagatagtactgtgtccaagtctgtgaagaatgca
atagatacagacagattactaaactggctggttgaaaattctgtcctgtcaattgctctg
gaaggtaatatagaccaagcacagtactgtgatcgtataaagggaattattgaactgttg
ggcagtaaattgtctttagatgaactcactaaaatttggagaattcagtcaggacaatct
tccactgtgattgaaaacatacataccattattgctgctgcagctgtgaagtttagctcc
gatcagctcaaccatttatttgttctaattcaaaagagctgggaaacagagagtgataga
gtgcgacagaagctgttgagcctgatagggcgcattggtcgagaagcacgggtggaaaca
accactggaaaggttctcgaggtgctctgggagctggctcatcttccaacattaccatgc
agtcttattcagcaggccttggaggaacatctgacaatcctcagcgatgcctatgcagtg
aaagaggcaatcaaaagaagctacatcatcaaatgcatagaggatattaagaggaaaatg
aagcctgccagaaaagcgatgagcagttctaacaatgagtcatcccagcacaataatcct
cagtttgtttgggtggtaccagcattacgtcagctccatgaaatcacacgttcttttatt
aaacaaacttaccaaaagcaagacaagagcattattcaagatctaaagaaaaactttgaa
atagtgaagttggtgacaggaagcttaatatcctgccaccgtttggctgcatctgtggca
ggtcctggagggcttgttggagcaaccttggtggatggccgatacacttaccgagagtat
ttggaagcacacctaaaatttttggcattttttctgcaagaagccaccctttatttgggc
tggaatcgtgccagggagatctgggagtgcctcgtaactggccaggacgtttgtgagtta
gatcgagagatgtgctttgagtggtttaccaaagggcagcatgatctagagagtgatgta
cagcaacagctcttcaaagagaagattcttaaactggaatcatatgaaattactatgaat
ggttttagtttatttaagactttctttgaaaatgtgaacctgtgtgaccatcgactgaag
aggcaaggaactcagctgagtgtagaaaaactggaattaataggaatggatttcatttgg
aagattgcaatggagtcacctgatgaagaaattgccaatgaagctattcaactgataatt
aactacagctatattaacctcactcctagactgaaaaaggattcggtatcgctgcacaag
aaattcattgctgattgctacacacgattggaggcagccagttcagcactcggtggtcca
acattaacacatgctgttacaagagctacaaaaatgcttacagcaactgctatgcctaca
gtagcaacatcagttcaatctccttacaggtctactaaacttgtaataattgagagactg
ctgttgttggcagagcgttatgtaataacaatagaggacctttactctgtgccccgaact
attctacctcatggtgcctcttttcatggacatcttttaactctcaatgttacatatgaa
tctaccaaagataccttcaccatagaggctcatagcaatgaaactgtagggagcatcagg
tggaagatagcaaagatgttgaattctcctgtggataacatacagatattcgccaatgac
agcctgctaacagtaaataaagatcagaaattactccaccaattgggcttctctgatgaa
caagtccttacggtgaaaacgtcaggcagtgggacaccttcagggagctcggctgattcc
tcaaccagttccagcaacagcagcagtgtatttagttcatcctatgcaatggaacaggag
aaatccctccctggagtggtcatggctctcgtgtgtaatgtgtttgatatgctttaccag
cttgccaatctagaggagccaagaataacactgcgagtgagaaaacttctgctcttaatt
cccactgacccagctattcaggaggcacttgatcagcttgattccctgggaaggaagaaa
acgctgctatcagaatcaggttctcagtcttcaaaatccccatccttgtcttcaaaacac
caacatcagcccagtgctagttcaatactggaaagtctgttcagatcttttgctccgggc
atgtctaccttcagagtactctacaatttagaggtactgagctccaagctgatgccaact
gcagatgatgaaatggcaagaaactgtgctaagtccttctgtgaaaattttctcagagca
ggaggtttgagtttggtggtgaatgtgatgcagagggattccattccatcagaagtagac
tatgaaaccagacagggggtctattccatctgcctgcaacttgcaaggttcttgcttgtt
ggccagacaatgcctaccttgctggatgaagattttattaaagatggagtagaagcattg
tcctcacgccccttccgtaatgtcagccgacaagcaagcaggcagatgtccatttgtgga
acacctgagaagtcatcctaccgacagctctctgtgtctgatagatcctccattagggta
gaagaaatcataccagcagcaagagttgccatacaaactatggaggtgaatgatttcact
tccaccgtggcttgcttcatgcgactctcttgggctgctgctgcaggacgactggacctc
gtaggaagtagtcagccaataaaagaaaacaacactttatttcctgcagggattcgaaac
agacttagcagctcaggaagtaattgcagctcaggaagtgaaggagagccaactgcactg
catgctggtatctgtgtgaggcagcagtccgtatctaccaaagatgctctgattgctgga
gaagccttgtctctgttagtaacatgccttcagctacgcagtcagcagctaggatctttt
tacaatttgccttgtgttgctgatttcattattgacatactgcttggatcaccaagtgct
gagattcgtcgtgttgcttgtgaccagttgtacacccttagtcaaactgatacatcaact
catccagatgtacaaaagccaaaccagtttctcctgagcgttatccttggtgcccagctg
cctctttggtcaccaaccagcatcatgagaggaattaaccagaggctcctgtcccagtgt
accgaatattttgatctgagatgtcagttattggatgacctcacttcatcagaaatggaa
cagctaaagataagcccagctgctatgttagaagatgagattacctggctagaaaacttt
gaacccaaccgcacagctgagtgtgagaccagtgaagctgataacatcctattagcagga
cacttgaggctcatcaagactctcctttcgctctgtggggcagagaaggaaatggttggt
tcatctttgattaagccattgttggatgacttcctcttccgagcatccaggattattctg
aatagccattctccagcaggcagtgctgcaatcagtcagcaagactttcatccaaagtgc
agtacagcagatagccgattagctgcctatgaagtgttagtaatgctggctaatagctca
ccttccaatcttcagcttattacgaaagagctgctttctatgcatcatcagtgtgaccca
gctcttaccaaggagtttgattatcttccaccagtggatagtcgctccatttcaggattt
gtgggactgaagaatggtggtgctacttgttatatgaatgctgtcttccagcagctgtat
atgcagcctggtctcccagaggctctgctttccattgatgatgataccgacaatccagat
gacaatgtgttctatcaagttcagtctctttttggtcacctgatggaaagcaaactacag
tattatgtacctgagaacttttggaagatcttcaagatgtggaataaggagctttatgtt
cgagagcaacaggatgcttacgagttctttaccagtcttatagatcaaatggatgagtac
ctcaaggtaaaatcttcagggatttttttccccatatacatgcat

DBGET integrated database retrieval system