KEGG   Meleagris gallopavo (turkey): 100545095Help
Entry
100545095         CDS       T01523                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100545095
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100545095
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100545095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 364 aa AA seqDB search
MWIEDYGFDGFRFDGVTSMLYHNHGIGKEFSGDYNEYFGLDVDEDALCYLMLANHMINFL
HPECITIAEDVSGMPALCRPIAEGGGGFDYRLAMAIPDKWIKIIKELKDEDWNMGNIVYT
LTNRRCDEKYIAYAESHDQALVGDKTLAFRLMDAEMYTNMSVFTPLTPVIDRGIQLHKMI
RLITHTLGGDGYLNFMGNEFGHPEWLDFPRKGNNESFHYARRQFNLTDDHLLRYKFLNEF
DRDMNKLEEKFGWLASPPAFVTEKHESNKVIAFERAGLLFIFNFHPYESYVDYRVGVEVP
GKYKIIMDSDASEYGGHQRLDHNTEYFSDEYPHNYRPNSVMSNSQTSFSQHSRRCHKHFI
KVKW
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtggattgaagattatggtttcgatggcttccgatttgatggtgttacatctatgctg
tatcacaatcatgggattggcaaagaattcagtggagattacaatgaatattttggccta
gatgtggatgaagatgctttgtgttatctgatgctggccaaccacatgattaacttcttg
catccggaatgcataacaatagcagaggatgtttctggaatgccagctctttgccgtcct
attgcagagggaggaggaggatttgattatcgactagccatggctattccagataagtgg
ataaagataattaaggagttgaaagatgaagactggaatatgggcaatattgtgtataca
ttaacaaacagacgatgtgatgagaaatatattgcatacgcagagagtcatgaccaggca
cttgttggtgataagacattggcatttcgattgatggatgcagagatgtacacaaacatg
agtgtgttcacacctctaactccagttattgatcgcggaatccagcttcataaaatgatt
cgcctcattactcacacacttggaggagatggctatctgaacttcatgggtaatgaattt
gggcatccagaatggcttgacttccccagaaaagggaataatgagagctttcactatgcc
agaagacagttcaatcttactgatgatcatcttcttcgctataaattcctaaatgagttt
gacagagatatgaataaattggaagaaaaatttggctggcttgcatctcctccggctttt
gtgactgaaaagcatgaatccaacaaggtcattgcatttgagagagctggtctccttttt
attttcaatttccatccatatgaaagttatgtggactacagagtgggtgttgaagttcca
ggaaagtataaaatcattatggattccgatgcttcagaatatggagggcatcaaaggttg
gaccacaatacagagtacttctctgacgaatatcctcacaattatcgacctaattcagtt
atgtccaattcacagaccagcttcagccaacactccagaagatgccacaagcacttcata
aaggtaaaatggtag

DBGET integrated database retrieval system