KEGG   Meleagris gallopavo (turkey): 100545097Help
Entry
100545097         CDS       T01523                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100545097
   00514 Other types of O-glycan biosynthesis
    100545097
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100545097
Glycosyltransferases [BR:mgp01003]
 Terminal extension
  Sialyltransferase
   100545097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 569 aa AA seqDB search
MLKIKKKKSXVVLMFLLRFRRCVVFLHQYFKARGAGKGIAMKPNLKQWKQLMLFGIFAWG
LLFLVIFIYFTDSNSAEPVPSSFSYIETKRLLPLQGKQRVIMGAIHDPSFSEAIDGNEVL
LNEDLLDTFKSETGSIKKWTDLEDAFRSEDEFFPSQIGRKSKSAFYQVNDDYFFAAGQPM
SHNNFQEIAKFISADEDNPKENILQNNWSRQRRMRRRSTKHRRSQMLDESDDWDGLYSTM
SKSFLYKLWKGDVSSKMLNPRLQKAMKDYLSTNKHGVRFKGKRNSKLTGDQLFCELKERV
NVRTIDGKEAPFSNLGWEKHVPQIPLGKLYTRGFGSCAVVMSAGAILNSSLGDEIDSHDA
VLRFNSAPTRGYEKDVGNKTTMRIINSQILTNPNHHFVDSSLYKDVILVAWDPAPYSANL
NVWYKKPDYNLFTPYVQHRRKNPNQPFYILHPKFIWQLWDIIQENTKEKIQPNPPSSGFI
GILIMMSMCNEVHVYEYIPSVRQTDLCHYHELYYDAACTLGAYHPLLYEKLLVQRMNKGL
QDDLYRKGKVILPGFKSVKCPERNDFPPL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaataaaaaagaaaaaatcttaagttgttttgatgtttcttcttcgtttcaga
agatgtgtcgttttccttcaccaatacttcaaggcaagaggagctggtaaaggcattgcc
atgaaacctaacttgaagcaatggaaacaactcatgctgttcggaatctttgcatggggt
ctgctttttctggtgatcttcatttatttcacagacagcaacagtgctgagccagttccc
agttccttttcttacattgaaacgaaaaggctcctgcccctgcagggcaagcagagagtc
atcatgggagccatacacgatccgtcattctctgaagccattgatgggaatgaggtactc
cttaatgaagatcttttagatacgtttaaatcagagactggaagtattaagaaatggact
gatttggaagatgcctttagaagcgaagatgagttttttccatcccagataggacgaaaa
tcaaaaagtgctttctaccaagtgaatgatgattatttcttcgctgctggtcagcctatg
tcacacaacaacttccaagagatagcaaaattcatctcagccgatgaggataatccaaaa
gagaatattttacagaacaactggagccgtcaaaggagaatgaggagaaggagcacaaag
cacagaagaagccagatgcttgatgaatctgatgactgggatgggctatattctacaatg
tcaaaatcctttctttacaagctttggaaaggagatgtctcttccaagatgctaaaccct
cgacttcagaaggcgatgaaagattatttgagcaccaataagcatggtgtgcggttcaaa
gggaaacgaaactcaaagctgacaggcgaccagcttttctgcgagctgaaagaaagggtg
aatgtgagaacaatagatggcaaggaagctcccttctccaatcttggatgggagaagcac
gttcctcaaattccgctgggcaaattgtatacgcgtggctttgggagttgtgccgtagtt
atgtctgctggtgcgatactgaactcctctctaggggatgaaatagattctcatgatgct
gttctaagatttaattctgctccaacacgcggctatgaaaaagatgttggaaataaaaca
acgatgcgaatcattaactctcagattctcaccaacccaaaccatcactttgtcgacagc
tctttatacaaagatgttatcttagtagcctgggatcctgccccttactctgcaaatttg
aatgtgtggtataagaaaccggactacaatctgttcactccctatgtacagcatcgcagg
aagaatccaaaccagcctttttacattctccatccaaagtttatatggcagctctgggac
atcattcaggagaacactaaagagaaaatacagcccaaccctccttcttcaggttttatt
ggtatcctcatcatgatgtccatgtgtaacgaagtgcacgtgtacgaatacatcccttca
gtccgacagaccgacttatgtcactaccacgaactctactacgatgcagcttgtacctta
ggggcttatcacccgctgctctatgagaagctgttggtgcagaggatgaacaaaggtttg
caggatgatctgtatcggaaggggaaggtcattttgccagggttcaagtctgtcaaatgc
ccggaacgaaatgatttcccacccttgtag

DBGET integrated database retrieval system