KEGG   Meleagris gallopavo (turkey): 100545097Help
Entry
100545097         CDS       T01523                                 

Gene name
ST6GAL2
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00510  N-Glycan biosynthesis
mgp00514  Other types of O-glycan biosynthesis
mgp01100  Metabolic pathways
Module
mgp_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100545097 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    100545097 (ST6GAL2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     100545097 (ST6GAL2)
Glycosyltransferases [BR:mgp01003]
 Terminal extension
  Sialyltransferase
   100545097 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 SPT6_acidic
Motif
Other DBs
NCBI-GeneID: 100545097
NCBI-ProteinID: XP_010726454
Ensembl: ENSMGAG00000014826
UniProt: G1NPP5
Position
1
AA seq 529 aa AA seqDB search
MKPNLKQWKQLMLFGIFAWGLLFLVIFIYFTDSNSAEPVPSSFSYIETKRLLPLQGKQRV
IMGAIHDPSFSEAIDGNEVLLNEDLLDTFKSETGSIKKWTDLEDAFRSEDEFFPSQIGRK
SKSAFYQVNDDYFFAAGQPMSHNNFQEIAKFISADEDNPKENILQNNWSRQRRMRRRSTK
HRRSQMLDESDDWDGLYSTMSKSFLYKLWKGDVSSKMLNPRLQKAMKDYLSTNKHGVRFK
GKRNSKLTGDQLFCELKERVNVRTIDGKEAPFSNLGWEKHVPQIPLGKLYTRGFGSCAVV
MSAGAILNSSLGDEIDSHDAVLRFNSAPTRGYEKDVGNKTTMRIINSQILTNPNHHFVDS
SLYKDVILVAWDPAPYSANLNVWYKKPDYNLFTPYVQHRRKNPNQPFYILHPKFIWQLWD
IIQENTKEKIQPNPPSSGFIGILIMMSMCNEVHVYEYIPSVRQTDLCHYHELYYDAACTL
GAYHPLLYEKLLVQRMNKGLQDDLYRKGKVILPGFKSVKCPERNDFPPL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctaacttgaagcaatggaaacaactcatgctgttcggaatctttgcatggggt
ctgctttttctggtgatcttcatttatttcacagacagcaacagtgctgagccagttccc
agttccttttcttacattgaaacgaaaaggctcctgcccctgcagggcaagcagagagtc
atcatgggagccatacacgatccgtcattctctgaagccattgatgggaatgaggtactc
cttaatgaagatcttttagatacgtttaaatcagagactggaagtattaagaaatggact
gatttggaagatgcctttagaagcgaagatgagttttttccatcccagataggacgaaaa
tcaaaaagtgctttctaccaagtgaatgatgattatttcttcgctgctggtcagcctatg
tcacacaacaacttccaagagatagcaaaattcatctcagccgatgaggataatccaaaa
gagaatattttacagaacaactggagccgtcaaaggagaatgaggagaaggagcacaaag
cacagaagaagccagatgcttgatgaatctgatgactgggatgggctatattctacaatg
tcaaaatcctttctttacaagctttggaaaggagatgtctcttccaagatgctaaaccct
cgacttcagaaggcgatgaaagattatttgagcaccaataagcatggtgtgcggttcaaa
gggaaacgaaactcaaagctgacaggcgaccagcttttctgcgagctgaaagaaagggtg
aatgtgagaacaatagatggcaaggaagctcccttctccaatcttggatgggagaagcac
gttcctcaaattccgctgggcaaattgtatacgcgtggctttgggagttgtgccgtagtt
atgtctgctggtgcgatactgaactcctctctaggggatgaaatagattctcatgatgct
gttctaagatttaattctgctccaacacgcggctatgaaaaagatgttggaaataaaaca
acgatgcgaatcattaactctcagattctcaccaacccaaaccatcactttgtcgacagc
tctttatacaaagatgttatcttagtagcctgggatcctgccccttactctgcaaatttg
aatgtgtggtataagaaaccggactacaatctgttcactccctatgtacagcatcgcagg
aagaatccaaaccagcctttttacattctccatccaaagtttatatggcagctctgggac
atcattcaggagaacactaaagagaaaatacagcccaaccctccttcttcaggttttatt
ggtatcctcatcatgatgtccatgtgtaacgaagtgcacgtgtacgaatacatcccttca
gtccgacagaccgacttatgtcactaccacgaactctactacgatgcagcttgtacctta
ggggcttatcacccgctgctctatgagaagctgttggtgcagaggatgaacaaaggtttg
caggatgatctgtatcggaaggggaaggtcattttgccagggttcaagtctgtcaaatgc
ccggaacgaaatgatttcccacccttgtag

DBGET integrated database retrieval system