KEGG   Meleagris gallopavo (turkey): 100545117Help
Entry
100545117         CDS       T01523                                 

Definition
glutaminase kidney isoform, mitochondrial-like
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mgp00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mgp00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mgp00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 630 aa AA seqDB search
MPGSFPRLCHASYGDDEKPKRKRDKERVPRFNAQPCLHQSHVKRKSEEILRGWIPVESLD
VKQAAVRLTVLSYAGASNYWEFSFYPNFSDKMKQGLLPSLEDLLFYTIAEGQEKIPVHKF
ITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKF
VIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSLCTVDGQRHSVGDTK
VPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAI
VVTSLIKQGANNAEKFDYVMQFMNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKK
CFPEGTDMVAILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSL
MHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGLMCWSPPLDKMGNSVKGIHFCH
DLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSGMDM
EQRDYDSRTALHVAAAEGHVDVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKIL
QEYQVQYTPTEDSNNGKENRTVHKNLDGLL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctcctttccccggctttgccacgcctcttatggagatgacgagaagccaaaa
aggaagcgagacaaggaaagagtgcctcgctttaacgcgcagccatgccttcatcagtct
catgttaagaggaagtcagaagagattctacgaggctggattccagtggaatcactggat
gttaagcaggcagctgttcgtctgactgtgctcagctatgcaggtgcatcaaattattgg
gagttttcattctacccaaacttctcagataaaatgaagcaaggtctccttcctagcttg
gaagatctgctcttctacactattgcggaaggacaagagaaaataccagtgcataaattc
ataactgcactcaaatctacaggattacgtacgtcggatcccaggttgaaagagtgcatg
gatatgttaagactgacccttcaaacaacttctgacggtgtgatgctggacaaagacctc
tttaaaaagtgtgtacaaagtaacattgtattgcttactcaagctttcaggaggaagttt
gtcatcccagattttatgtcatttacttcacacattgatgagctatatgaaagtgctaaa
aaacaatctggaggaaaggttgctgactatattccacagctggccaagttcagccctgac
ttgtggggtgtgtcactttgcacagtggatgggcagaggcattctgttggagataccaaa
gttcctttttgtcttcagtcctgtgtaaagcctttgaaatatgctattgctgttaatgat
cttggcacagagtatgtgcacagatacgttggtaaagagcctagtggattaagattcaac
aaattgttcctgaatgaagatgacaagcctcataaccctatggtgaacgctggagcaatt
gtggtcacgtctttaatcaagcaaggagcaaataatgcagaaaaatttgactacgttatg
caattcatgaataaaatggctggtaatgaatatgttggattcagtaatgctacgttccag
tctgaaagagagagtggagatagaaactttgcaattggctattacttgaaagagaaaaag
tgctttccggaaggcacagatatggttgctatactggacttttattttcagctttgctca
atagaagtaacctgtgagtcagcaagtgtgatggcagcaactctggctaacggtggcttt
tgcccaatcactggtgaaagagtcctgagtcctgaagcagtgcggaataccttgagttta
atgcattcctgtggcatgtatgacttctcagggcagtttgccttccatgtgggccttcct
gcaaaatctggagttgctggtgggattcttctggttgttccgaatgtcatgggcttaatg
tgctggtcacctcctttggacaagatgggcaacagtgttaaaggaattcacttttgtcat
gatctggtttctctgtgcaatttccataattatgataatttgagacactttgcgaaaaag
ctcgatcctcgccgagaaggtggtgatcagcgggtgaagtcagtgataaatctgctgttt
gctgcctacacgggggacgtgtctgcactccggagatttgctctgtcagggatggatatg
gagcagagagactatgactcacgaacagcattgcacgtagcagctgcagaaggacacgtg
gatgtcgtgaagttcctgctggaggcctgcaaagtgaatcccttccccaaagacagatgg
aataatactccaatggatgaagctttacattttggacaccacgatgtgtttaaaattctc
caggagtatcaggtccaatacacaccgacggaggattccaataatggcaaggagaaccga
acggttcataaaaacctggatggcttactataa

DBGET integrated database retrieval system