KEGG   Meleagris gallopavo (turkey): 100545151Help
Entry
100545151         CDS       T01523                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 1A-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100545151
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   100545151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 846 aa AA seqDB search
MVKTPTDTEHKWLIPAISVGPGLGHQWKPHPAATAAIPGPSGPEACQPTQHAVLAVNPNP
VLSKPGSGLEVETNSGKYFKAINFALKTPIIFLGGETSACKPSSVRLAPSFSFHAAGLQM
AGQMSHSHQQYSDRRQQNINDQQVSASSYTDRIQQPLTNQRRMPQTFRDPATAPLRKLSV
DLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDR
YEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMK
YYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLAT
PELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPY
DLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL
PDGTWNLKKTKDGKREYKPPATRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILR
MLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGS
SGTSNSGRARSDPTHQHRHSGGHFTAAVQAMDCETHSPQVRQQFPPPIGWTATEAPTQVT
VENHPVQETTFHVTPQQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGSRTRPRVYNSPT
NSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGA
MDMNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLAMRQGIDREESPMTGVCVQQ
SPVASS
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaactcccacagatacggagcacaagtggttaattcctgcaatttccgtgggt
ccaggactcggccaccaatggaagcctcatcctgcagcaacagcagcaattccaggacct
tctggtccagaggcgtgccaacctacacaacatgcagtactcgctgtcaatccaaaccct
gtactatcaaagccaggctctggcttggaggtggagactaactcaggtaaatattttaaa
gccattaactttgcattaaaaactcccattatctttctaggaggagagacttcagcatgc
aaaccttcatctgttcggcttgcaccatcgttttcattccatgctgctggccttcagatg
gctggacagatgtcccattcgcatcagcagtacagtgatcgtcggcagcagaacataaat
gaccaacaggtttctgcctcatcatacactgaccggattcagcaacctctaacaaaccag
aggcggatgccccaaactttccgtgatccagctactgctcctttgaggaagctctccgta
gatttgattaaaacatacaagcatattaatgaggtttactatgcaaaaaaaaaacggcgg
catcaacagggccaaggagatgattccagtcacaaaaaggagcgtaaagtttacaatgat
ggctatgatgatgacaactatgactatattgtaaaaaatggggagaagtggatggatcgt
tatgaaattgactctttaataggcaaaggatcctttggacaggttgtaaaagcttatgat
cgagtggaacaggaatgggtggctatcaaaataataaaaaacaaaaaagctttcttaaac
caagcccagattgaagtgcgactgcttgagcttatgaacaaacatgacactgagatgaag
tactatatagtgcatttgaagcgccacttcatgttccgaaaccacctctgcttagtcttc
gaaatgctgtcctacaatctgtatgatttgttgcggaacaccaacttcagaggtgtctca
ttgaatctgacaagaaaatttgcgcagcaaatgtgcactgcactgctttttctggcgact
cctgaacttagtatcattcactgtgacctaaaacctgagaatatcctgctctgtaacccc
aaacgaagcgccatcaagattgttgattttggcagttcttgtcaacttgggcagaggata
taccaatatatccagagccgtttctatcgatcgccagaggtgctactgggaatgccttac
gatcttgcaattgatatgtggtccctggggtgtattttagttgagatgcacactggagag
cctcttttcagtggggcaaatgaggtggatcaaatgaataaaatagtggaagttttgggg
ataccgcctgcccatatccttgaccaagcaccaaaagcaagaaagttctttgagaagttg
ccagatggcacttggaacttgaagaagaccaaagatggaaaaagggaatacaaaccacct
gcaactcgtaaacttcacaatatactaggagttgaaacaggaggaccaggtggacgtcgt
gctggggaatcgggtcacactgtagctgactacttgaagttcaaagacctcatcttaagg
atgcttgattatgaccctaagacacgaattcaaccttattatgccctacagcatagtttc
tttaagaaaacagcagacgaaggtaccaacacaagcaacagtgtgtctacgagtcctgcc
atggagcagtcacagtcttcaggaaccacctctagtacatcttcaagctcaggtggatct
tctggaacaagcaacagtggaagggcacggtcagaccccacacaccagcatcgacacagt
ggtggacacttcactgctgctgttcaagctatggactgtgaaacacacagcccacaggtt
cgacaacagtttcctcctccaattggttggacagccactgaagctcctacacaggtcact
gttgaaaaccatccagttcaagaaaccaccttccatgtaacccctcaacaacagaatgca
ttacatcatcatcacggaaatagctctcaccaccaccatcaccaccaccaccaccaccat
catcatggacagcaagccttgggtagccggaccaggccaagggtctacaattctccaaca
aacagctcctccacccaggattctatggaggtgggccacagtcaccactccatgacatcc
ctgtcttcctcaactacttcttcctctacatcttcctcctctactggtaaccaaggcaat
caggcctatcagaaccgcccagtggctgctaacaccttggactttggacaaaatggagct
atggacatgaatttaacagtctactctaatccgcgccaagaaactggcatagctggacat
ccaacgtaccagttttctgctaatacaggtcctgctcattacatgactgaaggacacctt
gcaatgaggcaagggattgatagagaagagtctcccatgacaggagtttgtgttcagcaa
agtcctgtggctagctcgtga

DBGET integrated database retrieval system