KEGG   Meleagris gallopavo (turkey): 100545151Help
Entry
100545151         CDS       T01523                                 

Gene name
DYRK1A
Definition
(RefSeq) dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100545151 (DYRK1A)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100545151 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 756 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMSHSHQQYSDRRQQNINDQQVSASSYT
DRIQQPLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSS
HKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIK
IIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDL
LRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDF
GSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVD
QMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPATRKLHNILG
VETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN
TSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQA
MDCETHSPQVRQQFPPPIGWTATEAPTQVTVENHPVQETTFHVTPQQQNALHHHHGNSSH
HHHHHHHHHHHHGQQALGSRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSST
SSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDMNLTVYSNPRQETGIAGHPTYQFSANTG
PAHYMTEGHLAMRQGIDREESPMTGVCVQQSPVASS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgttcggcttgcaccatcg
ttttcattccatgctgctggccttcagatggctggacagatgtcccattcgcatcagcag
tacagtgatcgtcggcagcagaacataaatgaccaacaggtttctgcctcatcatacact
gaccggattcagcaacctctaacaaaccagaggcggatgccccaaactttccgtgatcca
gctactgctcctttgaggaagctctccgtagatttgattaaaacatacaagcatattaat
gaggtttactatgcaaaaaaaaaacggcggcatcaacagggccaaggagatgattccagt
cacaaaaaggagcgtaaagtttacaatgatggctatgatgatgacaactatgactatatt
gtaaaaaatggggagaagtggatggatcgttatgaaattgactctttaataggcaaagga
tcctttggacaggttgtaaaagcttatgatcgagtggaacaggaatgggtggctatcaaa
ataataaaaaacaaaaaagctttcttaaaccaagcccagattgaagtgcgactgcttgag
cttatgaacaaacatgacactgagatgaagtactatatagtgcatttgaagcgccacttc
atgttccgaaaccacctctgcttagtcttcgaaatgctgtcctacaatctgtatgatttg
ttgcggaacaccaacttcagaggtgtctcattgaatctgacaagaaaatttgcgcagcaa
atgtgcactgcactgctttttctggcgactcctgaacttagtatcattcactgtgaccta
aaacctgagaatatcctgctctgtaaccccaaacgaagcgccatcaagattgttgatttt
ggcagttcttgtcaacttgggcagaggatataccaatatatccagagccgtttctatcga
tcgccagaggtgctactgggaatgccttacgatcttgcaattgatatgtggtccctgggg
tgtattttagttgagatgcacactggagagcctcttttcagtggggcaaatgaggtggat
caaatgaataaaatagtggaagttttggggataccgcctgcccatatccttgaccaagca
ccaaaagcaagaaagttctttgagaagttgccagatggcacttggaacttgaagaagacc
aaagatggaaaaagggaatacaaaccacctgcaactcgtaaacttcacaatatactagga
gttgaaacaggaggaccaggtggacgtcgtgctggggaatcgggtcacactgtagctgac
tacttgaagttcaaagacctcatcttaaggatgcttgattatgaccctaagacacgaatt
caaccttattatgccctacagcatagtttctttaagaaaacagcagacgaaggtaccaac
acaagcaacagtgtgtctacgagtcctgccatggagcagtcacagtcttcaggaaccacc
tctagtacatcttcaagctcaggtggatcttctggaacaagcaacagtggaagggcacgg
tcagaccccacacaccagcatcgacacagtggtggacacttcactgctgctgttcaagct
atggactgtgaaacacacagcccacaggttcgacaacagtttcctcctccaattggttgg
acagccactgaagctcctacacaggtcactgttgaaaaccatccagttcaagaaaccacc
ttccatgtaacccctcaacaacagaatgcattacatcatcatcacggaaatagctctcac
caccaccatcaccaccaccaccaccaccatcatcatggacagcaagccttgggtagccgg
accaggccaagggtctacaattctccaacaaacagctcctccacccaggattctatggag
gtgggccacagtcaccactccatgacatccctgtcttcctcaactacttcttcctctaca
tcttcctcctctactggtaaccaaggcaatcaggcctatcagaaccgcccagtggctgct
aacaccttggactttggacaaaatggagctatggacatgaatttaacagtctactctaat
ccgcgccaagaaactggcatagctggacatccaacgtaccagttttctgctaatacaggt
cctgctcattacatgactgaaggacaccttgcaatgaggcaagggattgatagagaagag
tctcccatgacaggagtttgtgttcagcaaagtcctgtggctagctcgtga

DBGET integrated database retrieval system