KEGG   Meleagris gallopavo (turkey): 100545155Help
Entry
100545155         CDS       T01523                                 

Definition
thrombospondin-2-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mgp04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:mgp04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:mgp04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1178 aa AA seqDB search
MLQRSRLLWLAVLITLWVSSDAQDDAKEEENTFDLLQISNINRKTIGAKLFRGPDPAIPA
YRFIRFDHIPPFKPEKLKKIVKLIRQNEGFILSAILRQDRQSRGTILALEGPGISERQFE
IISNGRANTLDLIYWVDGFQNVISLEDVDLADSQWKNLTVQVAGENYNLYVGCDLIDSFI
LEEPFYEQLKAENSRMYVAKGSIRENHFRGLLQNIHLIFDTSIEDVLRKKGCQRSQSTEV
NTINESTEILHLSPAVTTEYVGEKTEKKAEFCDRSCEELGTMFTELTGLRIVVNNLADNL
QKVSEENQIMWELIGPNKTLKNQSVCWQDGRVFADSESWIVDSCTKCTCQDSKIVCHQIT
CPPVSCADPSFIEGECCPVCSHSDDSEEGWSPWSDWTKCSVTCGSGTQMRGRSCDVTRSA
CTGPHIQTRMCSFKKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQMGGK
NCVGNGRETEKCEKAPCPVNGQWGPWSPWSACTVTCGGGLRERSRLCNSPEPQYGGKPCV
GDTKQHDMCNKRDCPIDGCLSNPCFPGAECNSYPDGSWSCGPCPAGFLGNGTVCEDLDEC
IAVSDVCFKVNQVHRCVNTNPGFHCLPCPPRYKGSQPYGVGLEVAKTEKQVCEPENPCKD
KTHSCHKSAECIYLGHFSDPMYKCECRTGYAGDGHICGEDSDLDGWPNNNLVCAANATYH
CVKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDEVGD
RCDNCPYVHNPAQIDTDNNGEGDSCAVDIDGDDIFNERDNCPYVYNTDQSDTDGDGVGDQ
CDNCPLMHNPDQTDADNDLVGDQCDNNEDIDEDGHQNNQDNCPYIPNANQADHDKDGKGD
ACDPDDDNDGIPDDRDNCRLRYNPEQEDSDGDGRGDICKDDFDNDNVPDIFDVCPENNAI
SETDFRKFQMVPLDPKGTAQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDFSGTF
YVNTDRDDDYAGFVFGYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGT
GEHLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGKQVM
VDSGPIYDTTFAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagaggagcaggctgttgtggcttgctgtcttgataaccctgtgggtttcctca
gatgctcaggatgatgccaaagaagaggagaatacctttgatttacttcagatcagtaac
ataaaccgaaagacaattggagcaaaattgtttcggggtccagatcccgctatcccagca
tatcgtttcattcggtttgaccatatacctccatttaaaccagagaagttaaaaaagatt
gttaaactcatacggcaaaatgagggctttattctttcagccatcctgagacaggacagg
caatctagaggcactatccttgctttagaaggtcctggcatcagtgagaggcagtttgag
ataatttccaatggccgagccaacaccctggacctcatttattgggtggatggcttccag
aatgtgatttccctggaagacgtggaccttgctgactcgcagtggaagaatctcaccgtg
caagtagcaggagagaactacaacctctatgttggctgtgaccttatcgacagtttcatc
ctggaggagcctttctatgagcaactgaaagcagagaacagcagaatgtatgtggcgaaa
ggatccattcgggagaatcatttcaggggtcttttacaaaatattcatttaatctttgat
acttccatagaggatgttctacgtaaaaaaggatgccagaggagccaatcaactgaagtg
aacaccatcaatgagagcactgaaatccttcacttgagccctgctgtcacgactgaatat
gtaggtgaaaaaacagagaagaaggctgagttctgcgaccggtcctgtgaagagctggga
acaatgttcactgagctcactggcctgcgcattgtggtgaacaatttagctgataacctc
caaaaagtgtctgaagagaaccaaattatgtgggaattgattgggcctaacaaaacactc
aagaaccaatcagtttgctggcaggatggcagagtctttgcagatagtgaaagctggatt
gtagatagctgcacaaagtgcacctgccaggactctaaaattgtgtgccatcaaatcact
tgtccaccagtttcttgtgctgatccatcctttattgaaggtgaatgctgtccagtctgc
tctcactctgatgatagtgaggaaggctggtcaccctggtcagactggacaaagtgctca
gttacctgtggctctgggactcagatgagaggaaggtcttgtgatgtcaccaggagtgct
tgtacaggcccacacattcagacaagaatgtgtagcttcaagaaatgtgaccatcggata
cgtcaggatggtggttggagtcactggtctccctggtcctcatgttcagttacttgtgga
gtaggaaatatcacccgcatccgcctctgcaattcccctattccccagatgggtgggaaa
aactgtgttggaaatggacgtgaaacagagaaatgtgagaaggccccatgcccggtgaat
ggccaatggggtccttggtctccatggtctgcttgcactgttacctgtggaggaggactc
cgtgagaggtctcgcctctgtaacagtccagagccacagtatggaggaaagccgtgtgtg
ggagatactaagcaacatgatatgtgcaataagagggattgcccaattgatggctgtttg
tcaaatccttgctttcctggagcagaatgcaacagttacccggatggatcttggtcatgt
gggccgtgtccagcaggttttcttggcaatggcacagtctgtgaggatcttgatgagtgt
atagctgtgtcagatgtttgctttaaggtgaatcaggtccatcgctgtgtgaacacgaat
ccgggtttccactgcttgccatgtcctccacgttataaaggaagtcagccctatggagta
gggctagaagttgccaagacagagaagcaagtctgtgaacctgagaatccgtgcaaagac
aagacacacagctgccataaatctgcagagtgcatctatctaggccatttcagtgatcct
atgtacaaatgtgaatgtaggacaggttatgctggtgatggacacatctgtggtgaggat
tcagatttggatggatggccgaataataacttggtctgtgctgctaatgctacatatcat
tgtgtgaaggataactgccccctcctgcctaactctggccaggaagactttgataaagat
ggcaaaggagatgcctgtgatgaggatgatgacaatgatggtgttgaagatgacaaagac
aattgccctcttctgttcaatcctcgtcagtttgattacgacaaagatgaagttggtgac
cgctgtgataattgcccttatgtgcacaaccctgcacagattgacacggataataatggg
gagggtgactcatgtgctgtggatattgatggagatgacatctttaatgaaagagataat
tgtccttacgtttataatacagaccagagtgatacagatggtgatggagttggtgatcag
tgtgataactgtccgctaatgcataatccagaccagactgatgcagataatgaccttgtt
ggtgaccagtgtgacaacaatgaggacattgatgaagatggccaccagaacaaccaagat
aactgcccttacatccccaatgctaaccaggctgaccatgataaagatggtaaaggggat
gcctgtgatcctgatgatgacaatgatgggattccagatgacagggacaattgtcgcctc
agatataaccctgagcaggaggactctgatggggatggcagaggtgatatttgcaaagat
gactttgacaatgacaatgttccggatatttttgatgtatgtcctgaaaataatgccatc
agtgaaactgatttcagaaagttccagatggtccctctggaccccaagggaacagctcag
attgatcccaactgggttattcgccaccaaggcaaggaactggtacagactgccaactct
gatcctggaatagctgtaggttacgatgagttcagctctgttgacttcagtggcacattc
tatgttaacacagaccgtgatgatgactatgctggctttgtttttggctaccagtccagc
agtcggttttatgttctaatgtggaagcaggtcactcagacgtactgggaggacaaaccc
accagggcttatggctattctggtgtgtcgctcaaggtagtgaattcaacaactggtact
ggtgaacacttgagaaatgctctttggcatacaggaaacacccccggacaggtgcgcact
ttatggcacgatcctaagaacattggctggaaagattatactgcatacaggtggcatttg
attcataggcctaaaacaggactaataaaagttctagtgtatgaagggaagcaagtcatg
gtggattctggaccaatctatgatacaacctttgctggtggacgattaggtctttttgtc
ttctctcaagaaatggtctatttctctgacctcaaatatgaatgcagagatgcttga

DBGET integrated database retrieval system