KEGG   Meleagris gallopavo (turkey): 100545155Help
Entry
100545155         CDS       T01523                                 

Definition
thrombospondin-2-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100545155
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100545155
  Cell communication
   04510 Focal adhesion
    100545155
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100545155
  Exosomal proteins of colorectal cancer cells
   100545155
  Exosomal proteins of bladder cancer cells
   100545155
Heparan sulfate/heparin binding proteins [BR:mgp00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100545155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1178 aa AA seqDB search
MLQRSRLLWLAVLITLWVSSDAQDDAKEEENTFDLLQISNINRKTIGAKLFRGPDPAIPA
YRFIRFDHIPPFKPEKLKKIVKLIRQNEGFILSAILRQDRQSRGTILALEGPGISERQFE
IISNGRANTLDLIYWVDGFQNVISLEDVDLADSQWKNLTVQVAGENYNLYVGCDLIDSFI
LEEPFYEQLKAENSRMYVAKGSIRENHFRGLLQNIHLIFDTSIEDVLRKKGCQRSQSTEV
NTINESTEILHLSPAVTTEYVGEKTEKKAEFCDRSCEELGTMFTELTGLRIVVNNLADNL
QKVSEENQIMWELIGPNKTLKNQSVCWQDGRVFADSESWIVDSCTKCTCQDSKIVCHQIT
CPPVSCADPSFIEGECCPVCSHSDDSEEGWSPWSDWTKCSVTCGSGTQMRGRSCDVTRSA
CTGPHIQTRMCSFKKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQMGGK
NCVGNGRETEKCEKAPCPVNGQWGPWSPWSACTVTCGGGLRERSRLCNSPEPQYGGKPCV
GDTKQHDMCNKRDCPIDGCLSNPCFPGAECNSYPDGSWSCGPCPAGFLGNGTVCEDLDEC
IAVSDVCFKVNQVHRCVNTNPGFHCLPCPPRYKGSQPYGVGLEVAKTEKQVCEPENPCKD
KTHSCHKSAECIYLGHFSDPMYKCECRTGYAGDGHICGEDSDLDGWPNNNLVCAANATYH
CVKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDEVGD
RCDNCPYVHNPAQIDTDNNGEGDSCAVDIDGDDIFNERDNCPYVYNTDQSDTDGDGVGDQ
CDNCPLMHNPDQTDADNDLVGDQCDNNEDIDEDGHQNNQDNCPYIPNANQADHDKDGKGD
ACDPDDDNDGIPDDRDNCRLRYNPEQEDSDGDGRGDICKDDFDNDNVPDIFDVCPENNAI
SETDFRKFQMVPLDPKGTAQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDFSGTF
YVNTDRDDDYAGFVFGYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGT
GEHLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGKQVM
VDSGPIYDTTFAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagaggagcaggctgttgtggcttgctgtcttgataaccctgtgggtttcctca
gatgctcaggatgatgccaaagaagaggagaatacctttgatttacttcagatcagtaac
ataaaccgaaagacaattggagcaaaattgtttcggggtccagatcccgctatcccagca
tatcgtttcattcggtttgaccatatacctccatttaaaccagagaagttaaaaaagatt
gttaaactcatacggcaaaatgagggctttattctttcagccatcctgagacaggacagg
caatctagaggcactatccttgctttagaaggtcctggcatcagtgagaggcagtttgag
ataatttccaatggccgagccaacaccctggacctcatttattgggtggatggcttccag
aatgtgatttccctggaagacgtggaccttgctgactcgcagtggaagaatctcaccgtg
caagtagcaggagagaactacaacctctatgttggctgtgaccttatcgacagtttcatc
ctggaggagcctttctatgagcaactgaaagcagagaacagcagaatgtatgtggcgaaa
ggatccattcgggagaatcatttcaggggtcttttacaaaatattcatttaatctttgat
acttccatagaggatgttctacgtaaaaaaggatgccagaggagccaatcaactgaagtg
aacaccatcaatgagagcactgaaatccttcacttgagccctgctgtcacgactgaatat
gtaggtgaaaaaacagagaagaaggctgagttctgcgaccggtcctgtgaagagctggga
acaatgttcactgagctcactggcctgcgcattgtggtgaacaatttagctgataacctc
caaaaagtgtctgaagagaaccaaattatgtgggaattgattgggcctaacaaaacactc
aagaaccaatcagtttgctggcaggatggcagagtctttgcagatagtgaaagctggatt
gtagatagctgcacaaagtgcacctgccaggactctaaaattgtgtgccatcaaatcact
tgtccaccagtttcttgtgctgatccatcctttattgaaggtgaatgctgtccagtctgc
tctcactctgatgatagtgaggaaggctggtcaccctggtcagactggacaaagtgctca
gttacctgtggctctgggactcagatgagaggaaggtcttgtgatgtcaccaggagtgct
tgtacaggcccacacattcagacaagaatgtgtagcttcaagaaatgtgaccatcggata
cgtcaggatggtggttggagtcactggtctccctggtcctcatgttcagttacttgtgga
gtaggaaatatcacccgcatccgcctctgcaattcccctattccccagatgggtgggaaa
aactgtgttggaaatggacgtgaaacagagaaatgtgagaaggccccatgcccggtgaat
ggccaatggggtccttggtctccatggtctgcttgcactgttacctgtggaggaggactc
cgtgagaggtctcgcctctgtaacagtccagagccacagtatggaggaaagccgtgtgtg
ggagatactaagcaacatgatatgtgcaataagagggattgcccaattgatggctgtttg
tcaaatccttgctttcctggagcagaatgcaacagttacccggatggatcttggtcatgt
gggccgtgtccagcaggttttcttggcaatggcacagtctgtgaggatcttgatgagtgt
atagctgtgtcagatgtttgctttaaggtgaatcaggtccatcgctgtgtgaacacgaat
ccgggtttccactgcttgccatgtcctccacgttataaaggaagtcagccctatggagta
gggctagaagttgccaagacagagaagcaagtctgtgaacctgagaatccgtgcaaagac
aagacacacagctgccataaatctgcagagtgcatctatctaggccatttcagtgatcct
atgtacaaatgtgaatgtaggacaggttatgctggtgatggacacatctgtggtgaggat
tcagatttggatggatggccgaataataacttggtctgtgctgctaatgctacatatcat
tgtgtgaaggataactgccccctcctgcctaactctggccaggaagactttgataaagat
ggcaaaggagatgcctgtgatgaggatgatgacaatgatggtgttgaagatgacaaagac
aattgccctcttctgttcaatcctcgtcagtttgattacgacaaagatgaagttggtgac
cgctgtgataattgcccttatgtgcacaaccctgcacagattgacacggataataatggg
gagggtgactcatgtgctgtggatattgatggagatgacatctttaatgaaagagataat
tgtccttacgtttataatacagaccagagtgatacagatggtgatggagttggtgatcag
tgtgataactgtccgctaatgcataatccagaccagactgatgcagataatgaccttgtt
ggtgaccagtgtgacaacaatgaggacattgatgaagatggccaccagaacaaccaagat
aactgcccttacatccccaatgctaaccaggctgaccatgataaagatggtaaaggggat
gcctgtgatcctgatgatgacaatgatgggattccagatgacagggacaattgtcgcctc
agatataaccctgagcaggaggactctgatggggatggcagaggtgatatttgcaaagat
gactttgacaatgacaatgttccggatatttttgatgtatgtcctgaaaataatgccatc
agtgaaactgatttcagaaagttccagatggtccctctggaccccaagggaacagctcag
attgatcccaactgggttattcgccaccaaggcaaggaactggtacagactgccaactct
gatcctggaatagctgtaggttacgatgagttcagctctgttgacttcagtggcacattc
tatgttaacacagaccgtgatgatgactatgctggctttgtttttggctaccagtccagc
agtcggttttatgttctaatgtggaagcaggtcactcagacgtactgggaggacaaaccc
accagggcttatggctattctggtgtgtcgctcaaggtagtgaattcaacaactggtact
ggtgaacacttgagaaatgctctttggcatacaggaaacacccccggacaggtgcgcact
ttatggcacgatcctaagaacattggctggaaagattatactgcatacaggtggcatttg
attcataggcctaaaacaggactaataaaagttctagtgtatgaagggaagcaagtcatg
gtggattctggaccaatctatgatacaacctttgctggtggacgattaggtctttttgtc
ttctctcaagaaatggtctatttctctgacctcaaatatgaatgcagagatgcttga

DBGET integrated database retrieval system