KEGG   Meleagris gallopavo (turkey): 100545155Help
Entry
100545155         CDS       T01523                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100545155 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100545155 (THBS2)
  Cellular commiunity
   04510 Focal adhesion
    100545155 (THBS2)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100545155 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100545155 (THBS2)
  Exosomal proteins of bladder cancer cells
   100545155 (THBS2)
Glycosaminoglycan binding proteins [BR:mgp00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100545155 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1182 aa AA seqDB search
MPGVMLQRSRLLWLAVLITLWVSSDAQDDAKEEENTFDLLQISNINRKTIGAKLFRGPDP
AIPAYRFIRFDHIPPFKPEKLKKIVKLIRQNEGFILSAILRQDRQSRGTILALEGPGISE
RQFEIISNGRANTLDLIYWVDGFQNVISLEDVDLADSQWKNLTVQVAGENYNLYVGCDLI
DSFILEEPFYEQLKAENSRMYVAKGSIRENHFRGLLQNIHLIFDTSIEDVLRKKGCQRSQ
STEVNTINESTEILHLSPAVTTEYVGEKTEKKAEFCDRSCEELGTMFTELTGLRIVVNNL
ADNLQKVSEENQIMWELIGPNKTLKNQSVCWQDGRVFADSESWIVDSCTKCTCQDSKIVC
HQITCPPVSCADPSFIEGECCPVCSHSDDSEEGWSPWSDWTKCSVTCGSGTQMRGRSCDV
TRSACTGPHIQTRMCSFKKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQ
MGGKNCVGNGRETEKCEKAPCPVNGQWGPWSPWSACTVTCGGGLRERSRLCNSPEPQYGG
KPCVGDTKQHDMCNKRDCPIDGCLSNPCFPGAECNSYPDGSWSCGPCPAGFLGNGTVCED
LDECIAVSDVCFKVNQVHRCVNTNPGFHCLPCPPRYKGSQPYGVGLEVAKTEKQVCEPEN
PCKDKTHSCHKSAECIYLGHFSDPMYKCECRTGYAGDGHICGEDSDLDGWPNNNLVCAAN
ATYHCVKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKD
EVGDRCDNCPYVHNPAQIDTDNNGEGDSCAVDIDGDDIFNERDNCPYVYNTDQSDTDGDG
VGDQCDNCPLMHNPDQTDADNDLVGDQCDNNEDIDEDGHQNNQDNCPYIPNANQADHDKD
GKGDACDPDDDNDGIPDDRDNCRLRYNPEQEDSDGDGRGDICKDDFDNDNVPDIFDVCPE
NNAISETDFRKFQMVPLDPKGTAQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDF
SGTFYVNTDRDDDYAGFVFGYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNS
TTGTGEHLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEG
KQVMVDSGPIYDTTFAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atgccaggagttatgctgcagaggagcaggctgttgtggcttgctgtcttgataaccctg
tgggtttcctcagatgctcaggatgatgccaaagaagaggagaatacctttgatttactt
cagatcagtaacataaaccgaaagacaattggagcaaaattgtttcggggtccagatccc
gctatcccagcatatcgtttcattcggtttgaccatatacctccatttaaaccagagaag
ttaaaaaagattgttaaactcatacggcaaaatgagggctttattctttcagccatcctg
agacaggacaggcaatctagaggcactatccttgctttagaaggtcctggcatcagtgag
aggcagtttgagataatttccaatggccgagccaacaccctggacctcatttattgggtg
gatggcttccagaatgtgatttccctggaagacgtggaccttgctgactcgcagtggaag
aatctcaccgtgcaagtagcaggagagaactacaacctctatgttggctgtgaccttatc
gacagtttcatcctggaggagcctttctatgagcaactgaaagcagagaacagcagaatg
tatgtggcgaaaggatccattcgggagaatcatttcaggggtcttttacaaaatattcat
ttaatctttgatacttccatagaggatgttctacgtaaaaaaggatgccagaggagccaa
tcaactgaagtgaacaccatcaatgagagcactgaaatccttcacttgagccctgctgtc
acgactgaatatgtaggtgaaaaaacagagaagaaggctgagttctgcgaccggtcctgt
gaagagctgggaacaatgttcactgagctcactggcctgcgcattgtggtgaacaattta
gctgataacctccaaaaagtgtctgaagagaaccaaattatgtgggaattgattgggcct
aacaaaacactcaagaaccaatcagtttgctggcaggatggcagagtctttgcagatagt
gaaagctggattgtagatagctgcacaaagtgcacctgccaggactctaaaattgtgtgc
catcaaatcacttgtccaccagtttcttgtgctgatccatcctttattgaaggtgaatgc
tgtccagtctgctctcactctgatgatagtgaggaaggctggtcaccctggtcagactgg
acaaagtgctcagttacctgtggctctgggactcagatgagaggaaggtcttgtgatgtc
accaggagtgcttgtacaggcccacacattcagacaagaatgtgtagcttcaagaaatgt
gaccatcggatacgtcaggatggtggttggagtcactggtctccctggtcctcatgttca
gttacttgtggagtaggaaatatcacccgcatccgcctctgcaattcccctattccccag
atgggtgggaaaaactgtgttggaaatggacgtgaaacagagaaatgtgagaaggcccca
tgcccggtgaatggccaatggggtccttggtctccatggtctgcttgcactgttacctgt
ggaggaggactccgtgagaggtctcgcctctgtaacagtccagagccacagtatggagga
aagccgtgtgtgggagatactaagcaacatgatatgtgcaataagagggattgcccaatt
gatggctgtttgtcaaatccttgctttcctggagcagaatgcaacagttacccggatgga
tcttggtcatgtgggccgtgtccagcaggttttcttggcaatggcacagtctgtgaggat
cttgatgagtgtatagctgtgtcagatgtttgctttaaggtgaatcaggtccatcgctgt
gtgaacacgaatccgggtttccactgcttgccatgtcctccacgttataaaggaagtcag
ccctatggagtagggctagaagttgccaagacagagaagcaagtctgtgaacctgagaat
ccgtgcaaagacaagacacacagctgccataaatctgcagagtgcatctatctaggccat
ttcagtgatcctatgtacaaatgtgaatgtaggacaggttatgctggtgatggacacatc
tgtggtgaggattcagatttggatggatggccgaataataacttggtctgtgctgctaat
gctacatatcattgtgtgaaggataactgccccctcctgcctaactctggccaggaagac
tttgataaagatggcaaaggagatgcctgtgatgaggatgatgacaatgatggtgttgaa
gatgacaaagacaattgccctcttctgttcaatcctcgtcagtttgattacgacaaagat
gaagttggtgaccgctgtgataattgcccttatgtgcacaaccctgcacagattgacacg
gataataatggggagggtgactcatgtgctgtggatattgatggagatgacatctttaat
gaaagagataattgtccttacgtttataatacagaccagagtgatacagatggtgatgga
gttggtgatcagtgtgataactgtccgctaatgcataatccagaccagactgatgcagat
aatgaccttgttggtgaccagtgtgacaacaatgaggacattgatgaagatggccaccag
aacaaccaagataactgcccttacatccccaatgctaaccaggctgaccatgataaagat
ggtaaaggggatgcctgtgatcctgatgatgacaatgatgggattccagatgacagggac
aattgtcgcctcagatataaccctgagcaggaggactctgatggggatggcagaggtgat
atttgcaaagatgactttgacaatgacaatgttccggatatttttgatgtatgtcctgaa
aataatgccatcagtgaaactgatttcagaaagttccagatggtccctctggaccccaag
ggaacagctcagattgatcccaactgggttattcgccaccaaggcaaggaactggtacag
actgccaactctgatcctggaatagctgtaggttacgatgagttcagctctgttgacttc
agtggcacattctatgttaacacagaccgtgatgatgactatgctggctttgtttttggc
taccagtccagcagtcggttttatgttctaatgtggaagcaggtcactcagacgtactgg
gaggacaaacccaccagggcttatggctattctggtgtgtcgctcaaggtagtgaattca
acaactggtactggtgaacacttgagaaatgctctttggcatacaggaaacacccccgga
caggtgcgcactttatggcacgatcctaagaacattggctggaaagattatactgcatac
aggtggcatttgattcataggcctaaaacaggactaataaaagttctagtgtatgaaggg
aagcaagtcatggtggattctggaccaatctatgatacaacctttgctggtggacgatta
ggtctttttgtcttctctcaagaaatggtctatttctctgacctcaaatatgaatgcaga
gatgcttga

DBGET integrated database retrieval system