KEGG   Meleagris gallopavo (turkey): 100545287Help
Entry
100545287         CDS       T01523                                 

Definition
dual specificity mitogen-activated protein kinase kinase 6-like
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Influenza A
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mgp04620]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mgp04912]
Human Diseases; Infectious diseases; Influenza A [PATH:mgp05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 365 aa AA seqDB search
MSQSRGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGEENFEVKADDLEPISELG
RGAYGVVEKMRHMPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKHVIDKGLTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAEKFSAEFVDFTSQCLKKNSK
ERPTYPELMFWKAYGFVELLLISTLNAVMLAIVTQISNEQRKLIAPGTTSVFCKLMPRGR
YEKDD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgagaggcaagaagagaaaccctgggctgaaaattcctaaagaagcattt
gagcaaccacagacgagctccacgccacccagggatctagactccaaagcctgcatctct
attggcgaggagaactttgaggtgaaagctgatgacctggagcccatctccgagctggga
cgaggtgcatacggggtggtggagaagatgcggcacatgcctagcgggcagatcatggca
gtgaagcgcatccgagccacggtgaacagccaagagcagaagaggttattgatggatctg
gatatctccatgaggacagtagattgccccttcaccgttactttctatggagcacttttc
cgagagggagatgtgtggatttgcatggagctgatggatacctcactggacaaattctac
aagcatgtcattgacaaaggcctgacgattcctgaggacatcttagggaaaatagctgtc
tctattgtaaaagcactagaacatctacacagtaagctctccgtgatccacagagatgta
aagccctctaacgtgttgatcaatacgcaggggcaggtgaaaatgtgcgattttggaatt
agcggttacctcgttgactcggttgctaaaaccatggatgcaggatgcaaaccctacatg
gctcctgaaagaattaacccggagttgaaccagaaggggtacagcgtcaaatctgatatc
tggagcctggggatcacaatgatcgagctggccatcctgcgctttccctatgactcctgg
gggacgcccttccagcagctcaagcaggtggtggaggagccatcgccgcagctcccagcg
gaaaagttctcagcagagttcgtcgattttacctcgcaatgcttgaagaagaattccaaa
gagcggccaacatacccagagcttatgttttggaaggcttatggctttgtggagctgttg
cttatcagcacgctgaatgctgtgatgctcgccatagtgacgcagatttccaatgaacaa
aggaaactaatagcccctgggaccacaagtgtgttttgtaaactgatgccacgaggcaga
tatgagaaagatgactga

DBGET integrated database retrieval system