KEGG   Meleagris gallopavo (turkey): 100545327Help
Entry
100545327         CDS       T01523                                 

Definition
retinoic acid receptor beta-like
Orthology
K08528  
retinoic acid receptor beta
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 448 aa AA seqDB search
MFDCMDVLAVSPAQMLDFYTASPSSCMLQEKALKACFSGLAQTEWQHRHSAQSVETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPTKQESTENYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPMKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPTS
NGNTAEHSPSISPSSVDNSSVSQSPMVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctagcagtgagccctgctcagatgctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaggctctcaaagcatgcttcagtggattg
gcacaaacagagtggcaacaccggcacagtgctcaatcagttgaaactcagagcaccagt
tctgaggaacttgttccaagccctccttcaccacttccacccccgcgtgtttacaagccc
tgttttgtctgtcaagacaaatcatctggatatcactatggtgtcagtgcttgtgaggga
tgtaagggctttttccgcaggagtatccagaagaacatggtttacacatgtcatagagat
aagaactgtgttatcaataaagttaccagaaatcgttgccagtactgcagactacagaag
tgctttgaagtgggaatgtccaaagaatctgtcagaaatgataggaacaaaaagaagaag
gaacctacaaagcaggagtccacagaaaactatgaaatgacagcagagctggatgatctc
actgagaagatccgaaaagctcaccaggaaaccttcccctcgctctgccagctgggaaaa
tacactacaaattctagtgcagaccatcgggttcgactggaccttgggctatgggacaaa
ttcagtgaacttgcaacaaagtgcattattaaaatagtggaatttgcaaaacgattgcca
ggctttacaagcttgaccattgcagaccagataactctacttaaagcagcctgcctggac
atactgatcctcagaatttgcacaagatacacaccggaacaagacaccatgacattttca
gatggccttaccctgaaccgaactcagatgcacaatgctggatttggccccctgaccgac
ctcgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaaccggt
ctccttagtgccatctgcttgatctgtggagatcgccaggaccttgaagaaccaatgaaa
gtggataagcttcaggaaccgttgcttgaagcactgaaaatttatatccgaaagagacga
cccaacaagcctcacatgtttccaaagatcttaatgaaaatcacagatcttcgtagcatc
agtgcaaaaggtgcggaacgtgtcattacattgaaaatggaaattcctggatccatgcca
cctcttattcaagaaatgttggagaactctgaaggacacgaaccactgacaccaacctca
aatggaaatactgcagaacacagcccgagtatctcacccagctcagtggataacagcagt
gtcagtcaatcccctatggtgcaataa

DBGET integrated database retrieval system