KEGG   Meleagris gallopavo (turkey): 100545327Help
Entry
100545327         CDS       T01523                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Transcription factors [BR:mgp03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100545327 (RARB)
Nuclear receptors [BR:mgp03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100545327 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 100545327
NCBI-ProteinID: XP_003207239
Ensembl: ENSMGAG00000011041
UniProt: G1NEZ7
Position
6
AA seq 448 aa AA seqDB search
MFDCMDVLAVSPAQMLDFYTASPSSCMLQEKALKACFSGLAQTEWQHRHSAQSVETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPTKQESTENYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPMKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPTS
NGNTAEHSPSISPSSVDNSSVSQSPMVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctagcagtgagccctgctcagatgctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaggctctcaaagcatgcttcagtggattg
gcacaaacagagtggcaacaccggcacagtgctcaatcagttgaaactcagagcaccagt
tctgaggaacttgttccaagccctccttcaccacttccacccccgcgtgtttacaagccc
tgttttgtctgtcaagacaaatcatctggatatcactatggtgtcagtgcttgtgaggga
tgtaagggctttttccgcaggagtatccagaagaacatggtttacacatgtcatagagat
aagaactgtgttatcaataaagttaccagaaatcgttgccagtactgcagactacagaag
tgctttgaagtgggaatgtccaaagaatctgtcagaaatgataggaacaaaaagaagaag
gaacctacaaagcaggagtccacagaaaactatgaaatgacagcagagctggatgatctc
actgagaagatccgaaaagctcaccaggaaaccttcccctcgctctgccagctgggaaaa
tacactacaaattctagtgcagaccatcgggttcgactggaccttgggctatgggacaaa
ttcagtgaacttgcaacaaagtgcattattaaaatagtggaatttgcaaaacgattgcca
ggctttacaagcttgaccattgcagaccagataactctacttaaagcagcctgcctggac
atactgatcctcagaatttgcacaagatacacaccggaacaagacaccatgacattttca
gatggccttaccctgaaccgaactcagatgcacaatgctggatttggccccctgaccgac
ctcgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaaccggt
ctccttagtgccatctgcttgatctgtggagatcgccaggaccttgaagaaccaatgaaa
gtggataagcttcaggaaccgttgcttgaagcactgaaaatttatatccgaaagagacga
cccaacaagcctcacatgtttccaaagatcttaatgaaaatcacagatcttcgtagcatc
agtgcaaaaggtgcggaacgtgtcattacattgaaaatggaaattcctggatccatgcca
cctcttattcaagaaatgttggagaactctgaaggacacgaaccactgacaccaacctca
aatggaaatactgcagaacacagcccgagtatctcacccagctcagtggataacagcagt
gtcagtcaatcccctatggtgcaataa

DBGET integrated database retrieval system