KEGG   Meleagris gallopavo (turkey): 100545349Help
Entry
100545349         CDS       T01523                                 

Definition
histone acetyltransferase MYST2-like
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
29
AA seq 625 aa AA seqDB search
MIGGGRRVAVERKTKRRRARNAGSSSDGTEDSDFSTDPEHTDSSESDATSRRSARVTRSS
ARLSQSSQDSSPVRNPPSFGAEEPVYSTRRVTRSQQQPAPVTPKKYPLRQTRSSGSETEQ
VVDFSDRDTKNAADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSMKDSGSDL
SHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQS
RDKQIEERMLAHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEH
RQTYGNTREPLLENLTSEYDLELFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYE
LDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISV
FEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNS
FLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEV
LLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIA
KEAKRSNSNKIMDPSCLKWTPPKGT
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgattggcggaggtcggcgagtcgctgttgaacgcaaaacaaagcggcgcagggcgagg
aatgcgggcagcagctcagatggaacagaagactccgatttctccacggatcccgagcat
acagacagctctgaaagcgatgccacatcacggcgatccgcccgtgtgacccgctcctca
gccaggctcagccagagctcccaagattccagcccggttcgcaatccgccgtcgtttgga
gcagaagaaccagtctattccacgaggagggtgacccgcagccagcagcagcctgcccct
gtgactccaaagaaatacccactccggcagacccgctcgtctggatcagaaacagagcaa
gtggttgacttttctgacagagacactaaaaatgcagcggatcacgatgagtctccacct
cgtactcccaccgggaatgccccttcctcagagtctgatattgatatctccagtccaaat
gtatcccatgatgagagcattgccaaggacatgtccatgaaggattctggaagtgacctg
tctcaccgccctaagcgccgccgcttccatgaaagctacaatttcaacatgaaatgtccc
actcctggttgtaactctttaggacacttaactggaaaacacgagcggcacttctccata
tcaggatgcccactgtatcacaatctgtcagcagatgagtgcaaggtgcgagcacagagc
cgggataaacagattgaggagagaatgctggcccatcggcaggacgacaacaacaggcac
gccaccaggcaccaggcaccaacagagagacagcttcgatacaaagagaaagtagctgaa
ctcaggaagaagaggaactcgggactaagcaaggagcaaaaagaaaaatacatggaacac
aggcaaacctatggcaatactagggaacctcttcttgagaacctgaccagtgagtatgac
cttgagcttttccgaagagcacaagcacgggcatctgaggacctggaaaagttgcggctc
cagggccagatcacagaaggcagcaatatgattaaaaccatcgcttttggccgctatgaa
ctggacacctggtatcactctccctacccagaggagtacgctcgcctgggacgtctctac
atgtgtgagttctgcctcaaatacatgaagagccagacaatactgcgcagacacatggca
aaatgtgtttggaaacatccaccaggtgatgaaatctaccgcaaaggctccatttcagtt
tttgaagttgatgggaaaaagaacaagatctactgtcaaaacctatgtctgctggcaaaa
cttttcttggaccataaaacattgtattatgatgttgaacccttcctcttctatgtcatg
acagaagctgacaacactggctgccacctgataggatatttctctaaggagaagaattct
tttctcaattacaatgtctcttgtatcctgacaatgccccagtacatgaggcaaggctat
ggcaagatgctcattgacttcagctatttgctttctaaagtagaagaaaaagttggctct
ccagagcgacctctgtctgatttgggtctcatcagctaccggagctactggaaggaagtt
ctccttcgttacctgcataatttccaaggaaaagagatctctataaaagaaatcagccag
gagactgcagtaaaccccgtcgacattgttagtaccttgcaggcactgcagatgctgaag
tactggaaggggaaacacctggtcctgaaaagacaggatctgattgatgaatggatagcc
aaagaggcaaaaagatccaacagcaataagataatggatcccagctgtttgaaatggacc
cctcctaagggaacttaa

DBGET integrated database retrieval system