KEGG   Meleagris gallopavo (turkey): 100545353Help
Entry
100545353         CDS       T01523                                 

Definition
erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100545353
Cellular antigens [BR:mgp04090]
 Proteins
  100545353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 309 aa AA seqDB search
MEHVLLGWVLLLGTWTGASAASSKNWLIKDVAMDMANNSFDDQYQGCIDLMEAELPELNS
TEFSNKIYAEGWRSATELWQSRSDNATSPVVLGQDQAIAVLAYTMEGDLYRVFNNATLTA
GRSRQHYLSSYPFKTLHFLLSRALQILRESQPQQCYNVYRGVKGIRFTAQQGQVVRFGQF
TSSSLKEKVAEGFAQGTFYWVETCYGVPIKEFSAYPYEDEVLIPPCEQFEVTSVTYKNGR
SEIHLRSQGNSSTYNCEFVKGKGCSAPAWGPGSRGSPGAFSAGRSSPMESPHLWLLILAA
AALAAVGES
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgtcctcctgggctgggtgctgctgctcggcacctggactggtgcatcggct
gccagcagcaagaactggttgatcaaggatgtggcgatggacatggccaacaactccttt
gatgaccagtaccagggctgcatcgacttgatggaagctgagctgccggagctgaacagc
accgagttctccaacaaaatctacgctgagggctggcgttctgccaccgagttgtggcag
agccggtcagataatgccaccagcccagtggtgctgggacaggatcaggccatagccgtg
ctggcgtatacgatggagggggatctgtaccgcgtgttcaacaacgccacgctcacggct
gggcgctccaggcagcactacctgagctcctaccccttcaagacgctgcatttcctcctg
agcagagccctgcagatcctgcgggaatcccagccccagcaatgctacaacgtctaccgc
ggcgtcaagggcatccgattcacggcacagcaaggccaggtggtccgcttcggccagttc
acatcctcctccttaaaagagaaagtcgctgaagggtttgcccagggcacattctactgg
gtggaaacctgctacggtgtgcccatcaaggaattctccgcatacccctatgaggacgaa
gtcctcatcccaccctgtgagcagtttgaggtcaccagcgtcacctacaagaacggcaga
agtgaaatccatctccgctcccaggggaatagcagcacctacaactgcgagttcgtgaag
ggtaagggctgcagtgctccagcatggggacccggctcacgtggctcgccgggtgctttc
agtgcaggccggagcagccccatggaatccccacacctctggctgctcatcctggcagcc
gcagccctggcagccgtgggagagtcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system