KEGG   Meleagris gallopavo (turkey): 100545401Help
Entry
100545401         CDS       T01523                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100545401 (EEA1)
   04145 Phagosome
    100545401 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1404 aa AA seqDB search
MKVCVTPTDLSEHYQNEHMGTEGRQELRDIPAVTGFICPLCMKSHGSAEELFKHYEAVHN
SGIDSTCGGEGHLSSERDEVSLLRQEVQDLQASLKEERWYSEELKKELEKLQGQQQQDSK
SDGLTTSTSTESLERQLEEIQVENFNIKQMKDLFEQKAAQLATEIVDLKAKYDEEISLRE
GAEQKMTNLTQELLKERSTIEDLKTELLQRPGVEDVAVLKKELVQVQTLMDKMTLERERE
SEKLKDECKHLQAEQANSEATINQLRAELAKGPQEVAVYVQELQKLQSLVKELEQKNQNL
TEKLLKKEQEYSQLEEKHNELSVSKKNVQASFHQKDLDCQQLQAKLSASEASIQRLQTEL
GEKGEASQKLKEELSEVETKYQHLKAECKQLQQQREEKEQHGLQLQSELSQLHSKLLETE
RQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRAEEQLKEKVANSTELQHQLDKAK
QQHQEQQTLQQNTTSKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKERE
DLYAKIQAGEGETAVLNQLQEKNHALQIQVTQLTEKLKNQSESHKQAQENLHEQVQEQKA
HLRAAQDRVLSLEANITELSSQLNESKEKVSQLDVQVKAKTELLLSAEASKAAQRADLQN
HLDTAQHALQDKQQELNKVSVQLDQVTAKLNDKQEYCAQLEANLKDYKEQHLYLEQKTEE
LEGQLKKLEADVLDAKASKEQALQELQQQRQQSTELDLRIAELSKQLEAEREATSSVKLD
LQKKSEALEQAKQQISKREEENASLKKNLEKSSQDTSKQLKELDCKMQAATSELQQVKLE
KDTLVKDLTATKEKLSKNSESFKKRKEELEKEIEKGKAAVAEMEKSYQEVKQQLQVQTES
VAKERNELKNSLEKKEGISKQLSIELDSTRAQVLEIQGLLKEKENSEQHLQGKLREIKES
FEQKKKHSETLQAELKTALLEKAELENKLQQQTILSAQELKAEKGKLADLQKTHEKNKEN
MEKLQLDLYGKESELLATRQDLKSTEEKLALAQEELVSSRNRIASNNQQIQELKKAKSAL
EQDASKKEQQLGEKTKMLQDLQNERILKEKDLANEKCKTTELQEIRNRLEKESAKLSEEL
RICKQEFEKEVANLKDAKQLLIQQKLELQGKIDNMNSTLEQEKKNQQAVKDQLKKREEEL
KKECAEIEAKLHSEVKEKEEENRKHEEKETKLTMQVTALNENLATMKKEWQSSQRRVSEL
EKQADDLRGDIAVLEATVQNNQDERRALLERCIKSEGEIEKLQSKLVEMKKKLDNTTAAM
QELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSA
KNALTPSSKKPVRVCDTCFNDLQG
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtgtgtaactcctactgatctgtctgaacattaccagaatgaacacatgggg
acagaaggaagacaggagcttcgtgacattccagctgttactggatttatctgtcctttg
tgtatgaagtctcatggatcagctgaggagctgttcaagcactatgaagcagttcataat
tctggcatcgattcaacttgtggaggggaaggtcacctgtcatcagaaagagatgaagta
tcactgctccgacaagaagtgcaagacttgcaagcttcactgaaggaggaaagatggtat
tcagaagagctgaagaaagaactagagaaattgcaggggcagcagcagcaagattctaag
tctgatggattgactacatctacatctacagaatcattagaacggcaactagaagagatc
caagtagaaaattttaatattaagcaaatgaaagacttatttgagcaaaaagcagcacaa
ctggccactgaaattgtggatcttaaagctaagtatgatgaagaaatcagccttcgggaa
ggtgcagaacagaaaatgacaaacctaacgcaggaactactgaaggagagaagtaccata
gaagacttaaagacagagctgctacaaaggcctggtgtggaagatgtggctgttcttaaa
aaggaattggtccaagttcagacactgatggacaaaatgactttggaacgtgagagagaa
tctgaaaagttgaaagatgagtgcaagcacttgcaggcagagcaggcaaattcagaggct
accattaatcagttaagagctgaacttgccaaaggacctcaggaggtagctgtatatgtt
caggagctgcaaaaacttcaaagtttagtcaaggagctagaacagaaaaaccagaatctg
actgagaagctgctgaagaaggagcaggagtacagccagctagaagaaaaacacaatgag
ctatctgtgagtaaaaagaatgtacaggcaagctttcaccagaaggacctggattgccaa
cagcttcaggcaaaactgtctgcatcagaagcttcgatacagagattacagacagagcta
ggtgagaagggagaagcaagccagaagcttaaagaagaattatccgaagtagaaacaaag
taccagcatcttaaggcagaatgtaaacagctccagcagcagagagaggaaaaagaacag
catggcttgcagctccagagcgagctcagtcagttgcatagtaagcttctagaaacagaa
cgccagctgggggaagcacatgggcggcttaaggagcagaggcagctctctagtgaaaag
ctgatggacaaagagcagcaggtggctgatcttcagttgaagctttctcgtgctgaagaa
cagctaaaggaaaaggtggcaaattccacggaattgcaacatcaattagataaggcaaag
caacagcaccaggaacagcagacgcttcaacaaaacacgacatcaaaacttcgagaagcc
cagaatgatttggagcaagtactacgacaaattggagataaggaccaaaaaattcaaaat
cttgaggccttgcttcaaaagagtaaggaaaatatctctctgcttgaaaaggaaagagag
gatttgtatgcgaaaattcaagctggtgaaggagaaactgcagttcttaaccagctacag
gagaaaaatcacgctctgcaaatacaggtaactcagctgacagagaagctgaagaatcaa
tcagaaagtcataaacaagcccaagaaaatttgcatgagcaagtgcaggaacagaaggca
catctaagagctgctcaagaccgtgtgctctctctggaagccaatatcactgagttgagc
agtcagctaaatgaaagtaaagagaaagtatcacaacttgatgtacaggtaaaagcaaaa
actgaattgctgctttcagctgaagcatcaaaagctgctcaaagagcagaccttcagaat
catctggacactgcccagcatgcactgcaagacaagcaacaggagttaaataaggtcagt
gttcagttggatcaggttacggctaagctgaatgacaagcaggaatactgcgctcagttg
gaagccaatctcaaagactacaaagagcaacatctttatttggaacagaaaactgaagag
ctagagggacagcttaagaaacttgaggctgacgttcttgatgctaaagcaagcaaagaa
caagctcttcaggagttacagcaacagcgacagcagtctacagaattagacctccggata
gcagagctgagtaaacaacttgaagcagaaagagaagctacgtctagtgttaaattggat
ttacagaagaaatctgaggcccttgaacaagcaaaacagcaaatctcaaagcgagaggag
gaaaatgccagcctcaaaaaaaatcttgagaaatcaagtcaagatacaagtaaacaactc
aaggaattagactgtaaaatgcaagcagcaacatcagagctgcaacaggtgaaattagag
aaggatactttggtaaaggaccttacagctaccaaagagaaactctcaaaaaattctgaa
tccttcaaaaaaaggaaggaagaattagaaaaagaaatagaaaaaggaaaagcagctgta
gcagaaatggaaaaatcttaccaagaagtaaaacagcagctccaggtacagacagagtct
gtagctaaagagaggaatgaattgaaaaactcactggaaaaaaaggaggggatttctaag
caattgtcaatagaacttgactcaacacgagcgcaagtactggaaattcagggtcttctg
aaagagaaagagaacagcgagcagcatcttcagggaaagctgagagaaataaaggaatct
tttgagcagaagaaaaagcatagtgaaacgctgcaagctgaattaaaaactgccctttta
gaaaaggcagaactggagaataaactgcaacagcagactattttgtcagctcaggagctt
aaagcagagaaaggaaaactagcagacttacagaagacccatgaaaaaaataaggaaaac
atggaaaagctgcagctggacctgtacgggaaagagtctgagctgttggcaaccaggcaa
gaccttaagtccacagaagaaaaactggctcttgctcaagaagaattagtttccagcaga
aaccgaattgccagcaataatcagcagattcaggaactgaagaaagcaaagtcagcgctg
gaacaggatgcatcaaagaaggagcagcaactgggcgagaagaccaaaatgctacaggat
cttcagaatgagaggattttaaaagaaaaagacttagctaatgaaaaatgtaaaacaaca
gagctccaggaaataaggaatagacttgaaaaagaaagtgccaagctgagcgaagagctt
agaatctgcaagcaagaatttgagaaggaggtggcaaatctcaaggatgcgaaacagcta
ctgattcaacagaaattagagcttcagggcaaaatagataatatgaattcaactctggaa
caggagaagaaaaaccaacaagctgtcaaagatcagctgaaaaagagagaagaggaactg
aagaaagaatgtgctgaaattgaagccaaactgcactcagaggtgaaagagaaagaagaa
gaaaaccggaaacacgaggagaaggagaccaagctcaccatgcaggtcacagctctcaat
gaaaacctggctaccatgaagaaagagtggcaaagcagtcagagacgggttagcgaactg
gagaaacaggcagatgatttacgtggggacattgctgtcttagaagcaactgtgcagaat
aatcaggatgagagaagagcattgctagagaggtgtataaaaagtgagggagaaattgaa
aagcttcaatccaaacttgtagaaatgaagaaaaagctggacaacactactgctgcaatg
caggagctaggccgagaaaaccagtcattacagatcaaacacacccaagctctcaacagg
aaatgggcagaagacaatgaggtacagaattgtatggcctgtggaaaaggcttttcagtg
acagtgagaaggcatcactgtagacagtgtggaaatatcttttgtgctgagtgctcagca
aagaatgccttaactccttcttctaagaagcctgtccgagtctgtgatacttgctttaat
gacttgcaaggataa

DBGET integrated database retrieval system