KEGG   Meleagris gallopavo (turkey): 100545525Help
Entry
100545525         CDS       T01523                                 

Gene name
GLB1
Definition
(RefSeq) galactosidase, beta 1
  KO
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100545525 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    100545525 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100545525 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100545525 (GLB1)
   00511 Other glycan degradation
    100545525 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100545525 (GLB1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100545525 (GLB1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100545525 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 652 aa AA seqDB search
MLRLLLPLAGLAELLCAANIPRRTFGIDYDCNCFVKDGRPFRYISGSIHYSRVPRYYWKD
RLLKMKMAGLDAIQTYVPWNYHETQMGVYDFSGDRDLEYFLQLASETGLLVILRAGPYIC
AEWDMGGLPAWLLEKESIVLRSSDSDYLTAVEKWMGVLLPKMKPHLYQNGGPIIMVQVEN
EYGSYFACDYDYLRSLLKIFRQHLGDEVVLFTTDGASQFHLKCGALQGLYATVDFAPGGN
VTAAFLAQRSSEPTGPLVNSEFYTGWLDHWGHRHAVVPSQTIAKTLNEILARGANVNLYM
FIGGTNFAYWNGANMPYMSQPTSYDYDAPLSEAGDLTEKYFALREVIGMYNQLPEGLIPP
TTSKFAYGNVRLQKVGTVVEVLDRLSPSGPVKSTYPLTFVQLKQYFGFVLYRTKLPKNCT
EPTQLSSPLNGVHDRAYVSVDGVQQGILERDKSLVINITGNAGANLDILVENMGRVNFGR
FNNDFKGLVSNLTLGQDILVEWEMYPLNIDGAVNHFIHGYPGQPKRSGGNPPSYEAPAFY
TGTLSIPGGIPDLPQDTYVKFPEWTKGQIWINGFNLGRYWPARGPQLTLFVPRNILVSSV
PNNVTVLELEHSPCSTQLCEIEFVDKPIINATTQYEIDAPPLFVRDVWLSHL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgctgctcccgctggccggcctggcggagctcctctgtgcggcgaatata
ccccggaggacttttgggattgattatgactgcaactgctttgtcaaggatgggcgccct
ttccgttacatctctggcagcattcactattcccgggtgcctcggtattactggaaagac
cgcctcttgaagatgaagatggctgggctggatgcaattcaaacgtatgtaccatggaac
taccatgaaacccagatgggcgtgtatgatttttctggtgacagagatctggagtatttc
ctgcagcttgctagtgaaactggcttgctggtgattctaagagctggaccttacatctgt
gcagaatgggacatgggtggtcttcctgcatggctgttggagaaggaatctattgttctg
agatcttctgattcagattacctgacagcagtggagaaatggatgggggtccttttgcca
aagatgaagcctcacctctatcaaaatggaggtccaatcatcatggtgcaggtggagaat
gaatatggaagctactttgcttgtgactatgactatctgcgttcccttctgaagatcttt
cgccagcatcttggggatgaggtggtgctgttcacaactgatggtgcaagccagtttcat
ttgaaatgtggagctcttcagggtctttatgcgacagtagactttgccccaggtggaaac
gtcacagcagcattcttagctcaaaggagcagtgaacctacaggccctttggttaattct
gagttttatactggatggctggatcactgggggcaccgtcacgctgttgtaccctcacaa
actatagctaaaactcttaatgaaatcctggcacgtggtgctaatgttaacctgtacatg
tttataggtggaactaactttgcctactggaatggtgctaatatgccttatatgtcacaa
cccactagttatgactatgatgctccactaagtgaagcaggggatctgactgaaaaatat
tttgccttgagggaagtcattggtatgtataaccagttaccagaaggtcttatccctcca
acaacatccaaattcgcctatgggaatgttcgcttgcagaaggtgggcactgtggtggag
gttcttgatcgactgtcaccttctggaccagtgaaaagcacttacccattaacctttgtt
cagctcaagcagtattttggatttgtactgtacagaacgaagcttccgaaaaactgcaca
gagccaacacagctgagttcacctttaaatggagtccatgatcgtgcctatgtctctgtg
gatggggttcagcaaggaatccttgaaagggacaagtcattagtgataaatataactggg
aatgctggagcaaatctggacatcttagtagagaatatgggccgagtcaattttggaaga
ttcaataacgatttcaagggtctggtttcaaatttaactcttggtcaagatatacttgtt
gaatgggaaatgtatcccctaaatatagacggagcagtgaaccatttcattcatggctac
cctggccaaccaaagagatctggtggcaatccacccagttacgaagcacctgccttctac
actggtacactttcaattcctggagggattccagacttgcctcaagacacctatgttaaa
tttcctgagtggacaaaggggcaaatttggatcaacggctttaatctcggtcgctactgg
ccagcccgtggccctcagttgaccctttttgttccaaggaatatacttgtttcatcagtg
ccaaacaacgtaacagtgttggagctggagcattctccatgcagcacccagctgtgtgag
atagaatttgtagacaaacctattattaatgcaaccacacagtacgaaattgatgcacca
cccctctttgttagagacgtgtggctgagccatctataa

DBGET integrated database retrieval system