KEGG   Meleagris gallopavo (turkey): 100545525Help
Entry
100545525         CDS       T01523                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mgp00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mgp00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:mgp00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:mgp00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mgp00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mgp04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 643 aa AA seqDB search
MVLEKELPKNIPRRTFGIDYDCNCFVKDGRPFRYISGSIHYSRVPRYYWKDRLLKMKMAG
LDAIQTYVPWNYHETQMGVYDFSGDRDLEYFLQLASETGLLVILRAGPYICAEWDMGGLP
AWLLEKESIVLRSSDSDYLTAVEKWMGVLLPKMKPHLYQNGGPIIMVQVENEYGSYFACD
YDYLRSLLKIFRQHLGDEVVLFTTDGASQFHLKCGALQGLYATVDFAPGGNVTAAFLAQR
SSEPTGPLVNSEFYTGWLDHWGHRHAVVPSQTIAKTLNEILARGANVNLYMFIGGTNFAY
WNGANMPYMSQPTSYDYDAPLSEAGDLTEKYFALREVIGMYNQLPEGLIPPTTSKFAYGN
VRLQKVGTVVEVLDRLSPSGPVKSTYPLTFVQLKQYFGFVLYRTKLPKNCTEPTQLSSPL
NGVHDRAYVSVDGVQQGILERDKSLVINITGNAGANLDILVENMGRVNFGRFNNDFKGLV
SNLTLGQDILVEWEMYPLNXDGAVNHFIHGYPGQPKRSGGNPPSYEAPAFYTGTLSIPGG
IPDLPQDTYVKFPEWTKGQIWINGFNLGRYWPARGPQLTLFVPRNILVSSVPNNVTVLEL
EHSPCSTQLCEIEFVDKPIINATTQYEIDAPPLFVRDVWLSHL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggtactggagaaagaactgccaaagaatataccccggaggacttttgggattgattat
gactgcaactgctttgtcaaggatgggcgccctttccgttacatctctggcagcattcac
tattcccgggtgcctcggtattactggaaagaccgcctcttgaagatgaagatggctggg
ctggatgcaattcaaacgtatgtaccatggaactaccatgaaacccagatgggcgtgtat
gatttttctggtgacagagatctggagtatttcctgcagcttgctagtgaaactggcttg
ctggtgattctaagagctggaccttacatctgtgcagaatgggacatgggtggtcttcct
gcatggctgttggagaaggaatctattgttctgagatcttctgattcagattacctgaca
gcagtggagaaatggatgggggtccttttgccaaagatgaagcctcacctctatcaaaat
ggaggtccaatcatcatggtgcaggtggagaatgaatatggaagctactttgcttgtgac
tatgactatctgcgttcccttctgaagatctttcgccagcatcttggggatgaggtggtg
ctgttcacaactgatggtgcaagccagtttcatttgaaatgtggagctcttcagggtctt
tatgcgacagtagactttgccccaggtggaaacgtcacagcagcattcttagctcaaagg
agcagtgaacctacaggccctttggttaattctgagttttatactggatggctggatcac
tgggggcaccgtcacgctgttgtaccctcacaaactatagctaaaactcttaatgaaatc
ctggcacgtggtgctaatgttaacctgtacatgtttataggtggaactaactttgcctac
tggaatggtgctaatatgccttatatgtcacaacccactagttatgactatgatgctcca
ctaagtgaagcaggggatctgactgaaaaatattttgccttgagggaagtcattggtatg
tataaccagttaccagaaggtcttatccctccaacaacatccaaattcgcctatgggaat
gttcgcttgcagaaggtgggcactgtggtggaggttcttgatcgactgtcaccttctgga
ccagtgaaaagcacttacccattaacctttgttcagctcaagcagtattttggatttgta
ctgtacagaacgaagcttccgaaaaactgcacagagccaacacagctgagttcaccttta
aatggagtccatgatcgtgcctatgtctctgtggatggggttcagcaaggaatccttgaa
agggacaagtcattagtgataaatataactgggaatgctggagcaaatctggacatctta
gtagagaatatgggccgagtcaattttggaagattcaataacgatttcaagggtctggtt
tcaaatttaactcttggtcaagatatacttgttgaatgggaaatgtatcccctaaatnna
gacggagcagtgaaccatttcattcatggctaccctggccaaccaaagagatctggtggc
aatccacccagttacgaagcacctgccttctacactggtacactttcaattcctggaggg
attccagacttgcctcaagacacctatgttaaatttcctgagtggacaaaggggcaaatt
tggatcaacggctttaatctcggtcgctactggccagcccgtggccctcagttgaccctt
tttgttccaaggaatatacttgtttcatcagtgccaaacaacgtaacagtgttggagctg
gagcattctccatgcagcacccagctgtgtgagatagaatttgtagacaaacctattatt
aatgcaaccacacagtacgaaattgatgcaccacccctctttgttagagacgtgtggctg
agccatctataa

DBGET integrated database retrieval system