KEGG   Meleagris gallopavo (turkey): 100545645Help
Entry
100545645         CDS       T01523                                 

Definition
glutathione peroxidase 7-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mgp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mgp00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 210 aa AA seqDB search
MLDPEGSVEHKPSSSFPKVFLIPLAMLLAITALLLLAFSTTQQKETDFYTFKVVNIRGKL
VSLEKYRGSVSLVVNVASECGFTDSHYKALQQLQKDLGPYHFNVLAFPCNQFGQQEPDTN
KEIESFARKTYGASFPMFSKVAVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVK
AWDSTVSVEEIRPHITELVRKIILKKKDEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctagatcctgagggcagtgtggagcacaagccttcctcttccttccctaaagttttt
ctcattcctctagccatgctccttgcaattacagcactcctgctcttagcgttttccacc
actcagcagaaagagactgatttttacacttttaaagttgtaaatatcaggggcaaacta
gtatctctggagaaatacaggggctcggtgtcattagttgtcaacgttgcaagtgaatgt
gggtttacagatagtcactacaaggccttacaacagttacagaaagacctcggcccatat
catttcaatgtgctggcattcccatgcaatcagtttgggcagcaagaaccagacaccaac
aaagaaatagagagttttgcacgaaagacatacggtgcctcctttcctatgttcagcaaa
gtcgcagtcagtggagctggtgcaattcctgctttcaagtacttaattgattctacagga
gaagaaccaacctggaacttctggaaatacttggtagaccccaatgggaaagtagtaaag
gcttgggactctactgtctctgttgaagaaataagacctcacattacagaacttgtgagg
aaaatcatcctgaagaaaaaagatgaattatga

DBGET integrated database retrieval system