KEGG   Meleagris gallopavo (turkey): 100545697Help
Entry
100545697         CDS       T01523                                 

Definition
TNF receptor-associated factor 2-like
Orthology
K03173  
TNF receptor-associated factor 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mgp04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mgp04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:mgp04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mgp04920]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mgp05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 633 aa AA seqDB search
MGILKSCPTGRRSSHGTSSACATSRASCDFEWDTCGWSSPSDERLHGFAWGWKSGVPLAK
YPGPKQDHTLGTEDGHYMHFDTRVLGAGGTAARLESQHLPATTAGCLHFWYHMDIPEHLY
STPPGSLDLNQPGFAKEILGTKLEVKYLCSDCRNILRRPFQAQCGHRYCSYCLKKIISSG
PQKCASCIQEGIYEEGVSILETSSAFPDNAARREVESLPAVCINEGCTWKGTIKEYESCH
EGNCPFLLIECQACRGVIPLNEKERHSERECPERTLNCKYCKSLFYFPDIKVRELYPAHR
RPLRDLEFQDHVKNCGKCKVPCRFEVVGCAEMVENEKLPEHESKCLAEHLYMLLSFVLSL
KSGSGGLKHLPALPSSQSSSPLLAANSLCPESELFKSLELLGRCDALEKXTVTFENIVCV
LNREVERVSLTAEAYSRQHRLDQEQIETLSNKVRQLERSIGLKDLAMAEMEEKIRNMEAS
TYDGVFIWKITEFARKRQEAITGRSPAIFSPAFYTSKYGYKMCLRVYLNGDGTGRGTHLS
LFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHIIDAFRPDVTSSSFQRPVTEMNIASG
CPLFCPVSVMEAKNSYVRDDAIFIKAIVDLSGL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggggattttaaagagctgccccacggggaggcggagcagccacgggacttcttcagcg
tgcgcgaccagcagagcatcctgtgactttgagtgggacacgtgtggctggagcagcccc
tcagatgagcgcctgcacggcttcgcctggggctggaagagcggcgtccccctggccaag
taccctggccccaagcaggaccacaccctgggcacagaggatggtcactacatgcacttc
gacacccgtgtgctgggcgcagggggcaccgctgcccggctggagagccagcacctcccc
gccaccactgccggctgcctgcacttctggtaccacatggacatcccggagcacctctat
tcgactccgcccggctctctggacctgaaccagcccgggtttgcgaaggagatcctggga
actaagctggaggtgaagtacctctgctcggactgcaggaacatactgaggcggcccttc
caggctcagtgcgggcatcgctattgctcctattgcttgaagaaaattataagttctggg
cctcaaaaatgtgcgagctgcattcaagaaggaatatatgaagaaggagtttctattttg
gaaaccagctctgctttcccagacaacgcagctcgtcgggaggtggaaagtctgcctgct
gtctgtattaacgagggctgcacgtggaaggggactattaaagagtatgagagctgccat
gaggggaactgcccgttcctgctgattgagtgccaggcatgcagaggtgtgatccctctg
aatgagaaggagcgccactctgagcgggagtgccccgagagaaccctcaactgcaaatac
tgcaaatcacttttctacttcccagatattaaggtacgagagttatatcctgcgcaccgc
aggccgctgcgggacctggagtttcaggaccacgtgaagaattgtggcaaatgtaaagtg
ccttgcagattcgaggttgttggctgtgctgagatggtggaaaatgaaaagctaccagaa
cacgaaagcaagtgtctggcagagcatctgtacatgctgctgagttttgtgctcagcctc
aagagtggatccggaggcctgaagcaccttcctgcccttccctcatcacagagcagctct
ccactgctggcagcaaactccctgtgcccagagtcggagctcttcaagtccctggagctc
ttgggaaggtgtgacgccctggagaagnaaacagtgacctttgagaacattgtctgcgtg
ctcaatagagaggtagaaagggtatctctgacagcagaagcgtacagccggcagcaccga
ttagaccaggagcagatcgagacactgagtaacaaggttcggcagctggaaaggagcatt
gggctgaaagacctggccatggctgagatggaggaaaagatccgcaacatggaggcttcc
acctacgatggtgttttcatctggaagataacagaatttgccaggaagcgccaggaagcg
atcacgggccgctctcctgcgatcttctctccagctttctacacaagcaagtatggctac
aagatgtgtctgcgcgtttacctgaatggggacggcaccgggcgtgggacccatctgtcc
ctgttcttcgtggtgatgaaaggacccaacgacgcgctcctgcgctggcccttcaaccag
aaggtgaccctgatgctcttggatcagaacaaccgggagcacatcatcgatgcgttccga
cccgacgtgacctcctcctccttccagcgcccggtcacagaaatgaacattgccagcggc
tgcccgctgttctgccccgtctccgtgatggaagccaagaactcttacgtccgcgatgac
gccatcttcattaaagccatcgttgacctctcaggcctttaa

DBGET integrated database retrieval system