KEGG   Meleagris gallopavo (turkey): 100545697Help
Entry
100545697         CDS       T01523                                 

Definition
TNF receptor-associated factor 2-like
Orthology
K03173  
TNF receptor-associated factor 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100545697
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100545697
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100545697
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100545697
  Endocrine system
   04920 Adipocytokine signaling pathway
    100545697
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100545697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 633 aa AA seqDB search
MGILKSCPTGRRSSHGTSSACATSRASCDFEWDTCGWSSPSDERLHGFAWGWKSGVPLAK
YPGPKQDHTLGTEDGHYMHFDTRVLGAGGTAARLESQHLPATTAGCLHFWYHMDIPEHLY
STPPGSLDLNQPGFAKEILGTKLEVKYLCSDCRNILRRPFQAQCGHRYCSYCLKKIISSG
PQKCASCIQEGIYEEGVSILETSSAFPDNAARREVESLPAVCINEGCTWKGTIKEYESCH
EGNCPFLLIECQACRGVIPLNEKERHSERECPERTLNCKYCKSLFYFPDIKVRELYPAHR
RPLRDLEFQDHVKNCGKCKVPCRFEVVGCAEMVENEKLPEHESKCLAEHLYMLLSFVLSL
KSGSGGLKHLPALPSSQSSSPLLAANSLCPESELFKSLELLGRCDALEKXTVTFENIVCV
LNREVERVSLTAEAYSRQHRLDQEQIETLSNKVRQLERSIGLKDLAMAEMEEKIRNMEAS
TYDGVFIWKITEFARKRQEAITGRSPAIFSPAFYTSKYGYKMCLRVYLNGDGTGRGTHLS
LFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHIIDAFRPDVTSSSFQRPVTEMNIASG
CPLFCPVSVMEAKNSYVRDDAIFIKAIVDLSGL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggggattttaaagagctgccccacggggaggcggagcagccacgggacttcttcagcg
tgcgcgaccagcagagcatcctgtgactttgagtgggacacgtgtggctggagcagcccc
tcagatgagcgcctgcacggcttcgcctggggctggaagagcggcgtccccctggccaag
taccctggccccaagcaggaccacaccctgggcacagaggatggtcactacatgcacttc
gacacccgtgtgctgggcgcagggggcaccgctgcccggctggagagccagcacctcccc
gccaccactgccggctgcctgcacttctggtaccacatggacatcccggagcacctctat
tcgactccgcccggctctctggacctgaaccagcccgggtttgcgaaggagatcctggga
actaagctggaggtgaagtacctctgctcggactgcaggaacatactgaggcggcccttc
caggctcagtgcgggcatcgctattgctcctattgcttgaagaaaattataagttctggg
cctcaaaaatgtgcgagctgcattcaagaaggaatatatgaagaaggagtttctattttg
gaaaccagctctgctttcccagacaacgcagctcgtcgggaggtggaaagtctgcctgct
gtctgtattaacgagggctgcacgtggaaggggactattaaagagtatgagagctgccat
gaggggaactgcccgttcctgctgattgagtgccaggcatgcagaggtgtgatccctctg
aatgagaaggagcgccactctgagcgggagtgccccgagagaaccctcaactgcaaatac
tgcaaatcacttttctacttcccagatattaaggtacgagagttatatcctgcgcaccgc
aggccgctgcgggacctggagtttcaggaccacgtgaagaattgtggcaaatgtaaagtg
ccttgcagattcgaggttgttggctgtgctgagatggtggaaaatgaaaagctaccagaa
cacgaaagcaagtgtctggcagagcatctgtacatgctgctgagttttgtgctcagcctc
aagagtggatccggaggcctgaagcaccttcctgcccttccctcatcacagagcagctct
ccactgctggcagcaaactccctgtgcccagagtcggagctcttcaagtccctggagctc
ttgggaaggtgtgacgccctggagaagnaaacagtgacctttgagaacattgtctgcgtg
ctcaatagagaggtagaaagggtatctctgacagcagaagcgtacagccggcagcaccga
ttagaccaggagcagatcgagacactgagtaacaaggttcggcagctggaaaggagcatt
gggctgaaagacctggccatggctgagatggaggaaaagatccgcaacatggaggcttcc
acctacgatggtgttttcatctggaagataacagaatttgccaggaagcgccaggaagcg
atcacgggccgctctcctgcgatcttctctccagctttctacacaagcaagtatggctac
aagatgtgtctgcgcgtttacctgaatggggacggcaccgggcgtgggacccatctgtcc
ctgttcttcgtggtgatgaaaggacccaacgacgcgctcctgcgctggcccttcaaccag
aaggtgaccctgatgctcttggatcagaacaaccgggagcacatcatcgatgcgttccga
cccgacgtgacctcctcctccttccagcgcccggtcacagaaatgaacattgccagcggc
tgcccgctgttctgccccgtctccgtgatggaagccaagaactcttacgtccgcgatgac
gccatcttcattaaagccatcgttgacctctcaggcctttaa

DBGET integrated database retrieval system