KEGG   Meleagris gallopavo (turkey): 100545733Help
Entry
100545733         CDS       T01523                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100545733
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100545733
Glycosyltransferases [BR:mgp01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100545733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 359 aa AA seqDB search
GLGFVTLLSFVSRFYRLPEPPHVCWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGY
LSGYDGTFPFQKPGDRYEQHNYMGMRGFCAFLGSCLVPFAYLTVLELSKSLPAALLTAFI
LIFDTGCITLSQYILLDPILMFFLMGAVLSMVKCNSCADRPFSASWWLWLSLTGVNLAGA
MGVKFVGLFVVLLVGLNTIYDLWDLLGNLSLSLVMFGKHFLARVLCLILLPLTLYVAMFA
VHFAVLNKSGPGDGFFSSAFQSQLIGNNLHNVSIPEHLAYGSVVTMKNLRMAGGYLHSHW
HLYPEGVGARQQQVTAYLHKDLNNLWIIKKHDSDTDLLDSSSPVEFVRHGDVIRLEHKE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gggctgggcttcgtcaccctcctcagcttcgtctcccgcttctaccgcctacccgagccg
ccgcacgtctgttgggatgaaacccactttgggaagatgggaagttactacattaaccgg
accttcttctttgatgtccatcctcctttggggaagatgctgattggacttgctggctac
ctgagtggatatgatggaacgtttccttttcaaaagccaggggacagatatgaacagcac
aactacatgggaatgagagggttctgtgcattccttggctcctgcctggtaccctttgcc
tacctcacagtgctagagctgtccaagtctctgccagcagccttactcacagctttcatc
cttatttttgatacaggctgtattactttgtctcagtatattctgcttgaccccattctg
atgttcttccttatgggagctgttctgagtatggtgaagtgtaactcctgtgcagatagg
ccattctctgcctcctggtggctgtggctgagtctgacaggggtgaaccttgctggagca
atgggggtgaagtttgttggcctttttgtggtcctgctggttggtctgaatacaatctat
gacctttgggacttgctggggaacctcagcttgtcactggtcatgtttgggaaacatttc
ctagctcgagtgctctgcctcatcttgcttccactcaccctctatgtggcgatgtttgct
gttcattttgcagtattaaataaaagtggtcctggggatggtttcttcagttctgccttt
cagtcccagctgattgggaacaatcttcataatgtctccattccagagcatttggcctat
gggtctgtggtcacgatgaagaaccttcggatggcagggggttacctacactcccactgg
cacctctacccagagggtgttggggctcgccagcagcaggtcacagcctacttacataag
gatttgaataacctgtggattataaagaagcatgattcagatacagatctgttggattcc
tccagccctgtggagtttgtgaggcatggagacgtcattcgcctggaacataaagagtaa

DBGET integrated database retrieval system