KEGG   Meleagris gallopavo (turkey): 100545777Help
Entry
100545777         CDS       T01523                                 

Gene name
PFN4
Definition
(RefSeq) profilin family, member 4
  KO
K05759  
profilin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100545777 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100545777 (PFN4)
Exosome [BR:mgp04147]
 Exosomal proteins
  Proteins found in most exosomes
   100545777 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 141 aa AA seqDB search
MIQLQTLLNESLIRTKHVENAAAIAINEREVCASTSGFYVPPENAINLIYAFYKNLLQVR
KEGLYFKQKHYKCVRADEHSIYLKNADGGLIVVKTKAFILIAMYRVGMYPSVCVEAVEKL
GKTNTCTCVPACQWFTDWLCS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgatccaacttcagactttgctgaatgaaagcctcatcagaacaaagcacgtggagaac
gcagctgcgatcgccataaatgaaagggaagtctgcgcttccacctctggcttctatgtg
ccaccagagaatgccataaacctcatctatgccttctacaagaacttgctgcaagttaga
aaggaaggactctacttcaagcagaagcactataagtgcgttcgagcagatgagcattcc
atctatcttaaaaatgcagatggaggcctcatagtggtgaagacaaaagctttcatcctg
attgctatgtacagagtgggcatgtatcccagtgtgtgtgtggaagctgtggagaaactc
ggtaagacaaacacatgtacctgtgtgcctgcatgtcagtggttcactgactggctctgc
tcttga

DBGET integrated database retrieval system