KEGG   Meleagris gallopavo (turkey): 100545849Help
Entry
100545849         CDS       T01523                                 

Gene name
COMT
Definition
(RefSeq) catechol-O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00140  Steroid hormone biosynthesis
mgp00350  Tyrosine metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100545849 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100545849 (COMT)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     100545849 (COMT)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100545849 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 PCMT Methyltransf_31 CmcI
Motif
Other DBs
NCBI-GeneID: 100545849
NCBI-ProteinID: XP_003210914
Ensembl: ENSMGAG00000001429
UniProt: G1MRP1
Position
17
AA seq 262 aa AA seqDB search
MLESSSVLLFIVFLLLFISLLCVVLIRKNGTAALIWHEIIKEKITNFIMNQSKEQRILNF
VLQNAVRGDPCSVMETIDKYCSEKEWAMNVGDVKGVILDKTVEEINPKVALELGTYCGYS
AVRIARLLKAGSRLLTVEFNPEFAAIAKQMIEFAGVQDKVKLLEGPSEVIIPQLKKKYEV
DTLDFVFLDHWKDRYAPDTILLQECSLLRKGSVLLADNIIFPGAPEFVKYIRNNPRFQCR
TYPSHLEYMKVQDAMEKAVFLG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagctcttcagtccttttgttcattgtcttccttctgcttttcatttcgttg
ctctgcgtggtactcatcaggaaaaatggcactgctgccctgatctggcatgaaataatc
aaggagaaaataaccaatttcatcatgaatcagagcaaagaacagaggattttaaatttt
gtgttgcagaatgcagtccgaggagacccctgtagcgtgatggaaactatagataaatac
tgctctgagaaagagtgggccatgaacgtgggtgatgtaaaaggcgtaattctggacaag
acagtggaagaaatcaatcctaaagttgcactggagctgggaacatactgtggctactca
gctgttaggattgctcggctgctgaaagcaggttctcgtcttctcactgtggagttcaac
ccagaatttgctgctatagctaaacagatgattgagtttgctggagtacaagataaggta
aaactcctagaaggcccttcagaggtaattatcccccagctgaaaaaaaaatatgaagtg
gatactctggattttgtcttcttggaccactggaaagacagatatgcaccagacaccatc
ctgcttcaggaatgcagcttgctgaggaagggctcagttcttctggctgacaatatcatc
ttcccaggagctcctgaatttgttaaatatatccgcaacaacccccgtttccaatgcagg
acgtacccatctcatctggaatatatgaaagtgcaggatgctatggaaaaggctgtgttt
ttgggataa

DBGET integrated database retrieval system