KEGG   Meleagris gallopavo (turkey): 100545867Help
Entry
100545867         CDS       T01523                                 

Gene name
PRKX
Definition
protein kinase, X-linked
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100545867 (PRKX)
   04310 Wnt signaling pathway
    100545867 (PRKX)
   04340 Hedgehog signaling pathway
    100545867 (PRKX)
   04020 Calcium signaling pathway
    100545867 (PRKX)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100545867 (PRKX)
   04210 Apoptosis
    100545867 (PRKX)
  Cellular commiunity
   04540 Gap junction
    100545867 (PRKX)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100545867 (PRKX)
   04912 GnRH signaling pathway
    100545867 (PRKX)
   04914 Progesterone-mediated oocyte maturation
    100545867 (PRKX)
   04916 Melanogenesis
    100545867 (PRKX)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100545867 (PRKX)
   04270 Vascular smooth muscle contraction
    100545867 (PRKX)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100545867 (PRKX)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100545867 (PRKX)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100545867 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 321 aa AA seqDB search
MLVSYVLCPFIIQSDGELSCSQKGILEEQPALLNVVVFKDSIPGDLGQQSIEKLKVCSSK
VQGPDPTLCQPHIPQDHASVCTGTFGRVHLVKEKMGKHYFALKVMSIPDVIRLKQEQHVH
NEKSVLKEVNHPFLIRLFWTYHDERFLYMLMEYVPGGELFSYLRNMGRFNNSTGLFYSTE
IICAIEYLHSKEIVYRDLKPENILLDKEGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEV
IQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDLYVKDLI
KKLLVVDRTRRLGNMKVSIKC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctggtttcctacgtcctctgcccatttattattcagagcgatggagagctctcatgc
tctcagaaaggcatccttgaagagcagccagctctcctcaacgtcgttgtctttaaggac
agcatcccaggggatcttggccaacaatccattgaaaaacttaaagtttgctcttccaaa
gttcagggtcctgaccccactctttgccagccccacattcctcaagatcacgcgagtgtc
tgcacaggtacatttgggcgtgttcacctggtgaaggaaaaaatgggaaaacattacttt
gcactgaaagtaatgagcattccagatgtcattcgactgaagcaagagcagcacgtgcac
aatgaaaagtcagttttgaaagaggtcaatcacccatttttgatcagattattctggacc
taccacgatgaacgttttttatacatgttaatggaatatgtaccaggaggagaacttttt
agttacctgcgcaacatggggcgtttcaacaacagcacaggactgttttactctacagaa
attatttgtgcaatagaatacctgcactccaaagaaatagtttacagagacttaaaacct
gaaaatatattgctagacaaagaaggacatatcaagcttactgattttggatttgctaaa
aaattggtggatagaacatggacactttgtggcactcctgaataccttgcaccagaagtc
atacaaagtaaaggacatgggagagctgtggattggtgggccctgggaattcttatattt
gagatgttgtcagggtttcctccattttttgatgacaatccatttggtatataccagaag
attcttgctggcaaaatagatttcccacggcatttggatttatatgtaaaagaccttatt
aagaagctacttgtggttgacaggacaagacgattaggaaatatgaaggtcagtataaaa
tgctag

DBGET integrated database retrieval system