KEGG   Meleagris gallopavo (turkey): 100545902Help
Entry
100545902         CDS       T01523                                 

Gene name
P4HB
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100545902 (P4HB)
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100545902 (P4HB)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100545902 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100545902 (P4HB)
  Exosomal proteins of bladder cancer cells
   100545902 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 407 aa AA seqDB search
SEAKVSWCSYLCGVAGREADDIVSWLKKRTGPAATTLTDAAAAETLVDSSEVVVIGFFKD
VTSDAAKEFLLAAESVDDIPFGISSSADVFSKYQLSQDGVVLFKKFDEGRNNFEGDLTKD
NLLNFIKSNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLDNFKAAAGNFK
GKILFIFIDSDHSDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDDLTADKIKEFC
NKFLEGKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQL
APIWDKLGETYRDHENIVIAKMDSTANEVEAVKIHSFPTLKFFPAGSGRNVIDYNGERTL
EGFKKFLESGGQDGAAADDDLEDLETDEETDLEEGDDDEQKIQKDEL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
tctgaggcaaaagtaagttggtgttcttatctttgtggtgtagctggcagagaagcagat
gatattgtcagttggctgaagaagcgcacgggcccggctgccactaccttgacagatgct
gctgcagcagaaacgttggtggattccagtgaagtggttgtgattggtttctttaaggat
gtgacgtcagatgctgcgaaggagtttttgttggcagcagaatctgtggatgacattcct
tttgggatttcttccagcgctgacgttttctccaaataccagcttagccaagatggagtg
gtcctcttcaagaagtttgatgaaggacgtaacaactttgaaggggatcttacgaaagat
aacttgctgaacttcatcaagtctaaccagttgcctcttgtcatagagtttactgagcag
accgctcctaaaatctttggaggagagatcaagactcacattctgctgttcttaccaaaa
agtgtgtctgattatgaagggaagttggacaacttcaaggctgcagctggaaacttcaaa
gggaagatcctgttcatcttcatagacagtgaccacagtgataatcaaaggattctggag
ttctttggcctgaagaaagaagaatgtccagctgtacgcttgataacactagaagaagaa
atgaccaaatacaaacctgaatcagatgacctcacagctgataagatcaaggaattctgt
aacaagttcctggagggcaagatcaagcctcacctgatgagccaggatctccctgaagac
tgggacaagcagcctgtcaaagttctcgttgggaagaattttgaggaagttgcttttgat
gagaataagaatgtctttgtggagttctatgccccctggtgtggtcactgtaagcagctg
gctcctatctgggacaagctgggagagacctacagggaccatgagaacattgtcattgcc
aagatggattcaacagccaatgaagtagaggcagtgaaaattcacagcttccccacactc
aagttcttccctgcaggctctggcagaaacgtaattgactataatggggagaggacacta
gaaggcttcaaaaaattcttggagagtggaggccaggatggagcagcagctgatgatgat
ctggaagatctggagacagatgaagaaacagaccttgaggaaggtgatgatgatgagcaa
aaaatccaaaaggatgaattgtaa

DBGET integrated database retrieval system