KEGG   Meleagris gallopavo (turkey): 100545902Help
Entry
100545902         CDS       T01523                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100545902
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100545902
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100545902
  Exosomal proteins of colorectal cancer cells
   100545902
  Exosomal proteins of bladder cancer cells
   100545902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 409 aa AA seqDB search
MGGLIYAGSERSGGVNAGREADDIVSWLKKRTGPAATTLTDAAAAETLVDSSEVVVIGFF
KDVTSDAAKEFLLAAESVDDIPFGISSSADVFSKYQLSQDGVVLFKKFDEGRNNFEGDLT
KDNLLNFIKSNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLDNFKAAAGN
FKGKILFIFIDSDHSDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDDLTADKIKE
FCNKFLEGKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCK
QLAPIWDKLGETYRDHENIVIAKMDSTANEVEAVKIHSFPTLKFFPAGSGRNVIDYNGER
TLEGFKKFLESGGQDGAAADDDLEDLETDEETDLEEGDDDEQKIQKDEL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggggggtcttatatatgctgggagtgaaaggagcggtggtgtaaatgctggcagagaa
gcagatgatattgtcagttggctgaagaagcgcacgggcccggctgccactaccttgaca
gatgctgctgcagcagaaacgttggtggattccagtgaagtggttgtgattggtttcttt
aaggatgtgacgtcagatgctgcgaaggagtttttgttggcagcagaatctgtggatgac
attccttttgggatttcttccagcgctgacgttttctccaaataccagcttagccaagat
ggagtggtcctcttcaagaagtttgatgaaggacgtaacaactttgaaggggatcttacg
aaagataacttgctgaacttcatcaagtctaaccagttgcctcttgtcatagagtttact
gagcagaccgctcctaaaatctttggaggagagatcaagactcacattctgctgttctta
ccaaaaagtgtgtctgattatgaagggaagttggacaacttcaaggctgcagctggaaac
ttcaaagggaagatcctgttcatcttcatagacagtgaccacagtgataatcaaaggatt
ctggagttctttggcctgaagaaagaagaatgtccagctgtacgcttgataacactagaa
gaagaaatgaccaaatacaaacctgaatcagatgacctcacagctgataagatcaaggaa
ttctgtaacaagttcctggagggcaagatcaagcctcacctgatgagccaggatctccct
gaagactgggacaagcagcctgtcaaagttctcgttgggaagaattttgaggaagttgct
tttgatgagaataagaatgtctttgtggagttctatgccccctggtgtggtcactgtaag
cagctggctcctatctgggacaagctgggagagacctacagggaccatgagaacattgtc
attgccaagatggattcaacagccaatgaagtagaggcagtgaaaattcacagcttcccc
acactcaagttcttccctgcaggctctggcagaaacgtaattgactataatggggagagg
acactagaaggcttcaaaaaattcttggagagtggaggccaggatggagcagcagctgat
gatgatctggaagatctggagacagatgaagaaacagaccttgaggaaggtgatgatgat
gagcaaaaaatccaaaaggatgaattgtaa

DBGET integrated database retrieval system