KEGG   Meleagris gallopavo (turkey): 100545934Help
Entry
100545934         CDS       T01523                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100545934
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100545934
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100545934
Translation factors [BR:mgp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100545934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 224 aa AA seqDB search
MTTSELLSVDFAQETTPNPQPSEEEKTEPAPTQEVASPEQYIKHPLQNRWALWFFKNDKS
KTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRW
LITLTKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRTKGDKIAIWTTECENR
DAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctctgagctgctctctgtcgattttgcacaagaaaccactcccaaccctcaa
ccttcagaagaggagaaaaccgagccagcgcctactcaggaggttgccagccctgaacag
tatattaagcatccactacaaaacagatgggcgctctggttttttaaaaatgacaagagc
aaaacttggcaagcaaacctccgtctgatctcaaagtttgatactgttgaagatttttgg
gctttatacaaccatatccagctctctagtaatttaatgcctggttgtgactactcgctg
tttaaggatgggattgaacccatgtgggaagatgaaaaaaacaagcgaggaggccgatgg
ctaattacactaaccaaacagcagagacgaagtgaccttgatcgcttctggctagagaca
ctgctgtgccttattggggagtcatttgatgactacagcgatgatgtatgtggtgctgtt
gttaatgttagaactaaaggtgataaaatagcaatatggacaactgaatgtgaaaacagg
gatgctgttacgcatatagggagagtatacaaggaaagattaggacttcctccaaagata
gtgattggttatcagtcccatgcagacacagctactaagagcggctccaccactaaaaat
aggtttgttgtttaa

DBGET integrated database retrieval system