KEGG   Meleagris gallopavo (turkey): 100545934Help
Entry
100545934         CDS       T01523                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mgp03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:mgp04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mgp04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 224 aa AA seqDB search
MTTSELLSVDFAQETTPNPQPSEEEKTEPAPTQEVASPEQYIKHPLQNRWALWFFKNDKS
KTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRW
LITLTKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRTKGDKIAIWTTECENR
DAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctctgagctgctctctgtcgattttgcacaagaaaccactcccaaccctcaa
ccttcagaagaggagaaaaccgagccagcgcctactcaggaggttgccagccctgaacag
tatattaagcatccactacaaaacagatgggcgctctggttttttaaaaatgacaagagc
aaaacttggcaagcaaacctccgtctgatctcaaagtttgatactgttgaagatttttgg
gctttatacaaccatatccagctctctagtaatttaatgcctggttgtgactactcgctg
tttaaggatgggattgaacccatgtgggaagatgaaaaaaacaagcgaggaggccgatgg
ctaattacactaaccaaacagcagagacgaagtgaccttgatcgcttctggctagagaca
ctgctgtgccttattggggagtcatttgatgactacagcgatgatgtatgtggtgctgtt
gttaatgttagaactaaaggtgataaaatagcaatatggacaactgaatgtgaaaacagg
gatgctgttacgcatatagggagagtatacaaggaaagattaggacttcctccaaagata
gtgattggttatcagtcccatgcagacacagctactaagagcggctccaccactaaaaat
aggtttgttgtttaa

DBGET integrated database retrieval system